Protein Info for Psest_3673 in Pseudomonas stutzeri RCH2

Annotation: Uncharacterized conserved protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 PF04285: DUF444" amino acids 4 to 419 (416 residues), 612.4 bits, see alignment E=2.5e-188

Best Hits

Swiss-Prot: 99% identical to Y721_PSEU5: UPF0229 protein PST_0721 (PST_0721) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K09786, hypothetical protein (inferred from 99% identity to psa:PST_0721)

Predicted SEED Role

"FIG002076: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GQ70 at UniProt or InterPro

Protein Sequence (423 amino acids)

>Psest_3673 Uncharacterized conserved protein (Pseudomonas stutzeri RCH2)
MSYVIDRRLNGKNKSTVNRQRFLQRYRGHIKKAVEEAVGRRSITDMEHGEQISIPGRDID
EPVLHHGRGGRQTIVHPGNKEFVAGERIPRPQGGGGGQGAGQASNSGDGMDDFVFQITQE
EFLDFMFEDLELPNLVKRHLTGTDTFKTVRAGIANEGNPSRINIVRTLRSAHARRIALSG
SSRSQLRALKAELERLRLEEPNNFGDIKATEEEIERLKARINRVPFLDTFDLKYNLLVKH
PNPSSKAVMFCLMDVSGSMTQATKDIAKRFFILLYLFLKRNYDKIDVVFIRHHTSAKEVD
EEEFFYSRETGGTIVSSALKMMQEIMAERYPANEWNIYAAQASDGDNWNDDSPLCRDILI
NQIMPFVQYFTYVEITPREHQALWYEYNQVAEAFSDAFAQQQLVSAADIYPVFRELFQRR
MTS