Protein Info for PGA1_262p00090 in Phaeobacter inhibens DSM 17395

Annotation: putative exopolysaccharide biosynthesis transport protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 703 transmembrane" amino acids 42 to 62 (21 residues), see Phobius details amino acids 424 to 445 (22 residues), see Phobius details amino acids 453 to 468 (16 residues), see Phobius details PF02706: Wzz" amino acids 28 to 118 (91 residues), 43.3 bits, see alignment E=9.5e-15 PF13807: GNVR" amino acids 368 to 442 (75 residues), 36.8 bits, see alignment E=7.5e-13 TIGR01007: capsular exopolysaccharide family" amino acids 492 to 687 (196 residues), 121.9 bits, see alignment E=1.3e-39 PF01583: APS_kinase" amino acids 511 to 557 (47 residues), 20.8 bits, see alignment 8.4e-08 PF13614: AAA_31" amino acids 511 to 630 (120 residues), 37.3 bits, see alignment E=6.6e-13 PF01656: CbiA" amino acids 512 to 554 (43 residues), 26.7 bits, see alignment 1.2e-09

Best Hits

Predicted SEED Role

"FIG00919408: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DW77 at UniProt or InterPro

Protein Sequence (703 amino acids)

>PGA1_262p00090 putative exopolysaccharide biosynthesis transport protein (Phaeobacter inhibens DSM 17395)
MGKPTTMGSTNVSTPKTSFAADDGQEVLDLGAIFAIIWRGRWVIAACVLIGLIVGIWRAY
IVATPLYGAEVQLVLDPRDEKVVDIESVVSSLSATDEVIRTEVHILGGRELAGQVVDRLN
LISDPEFNMMLRDPGFNPVQVLKDMIKGILGMQVYDTSLTPDPAFVREKVIQTLLANTRV
VNIPDTYIFSIWVLSENPFKAADIANAFADTYVENQVAVKLNVTEQATGWLAERVTELRS
QLEMNERRVADIRAQADVTSPAQLIGLENRLISLRSALAERAAEVAEQQAAQTELTSLQT
VEEQRVAARRNGYGAILARADNPQDGWRSVLAQLARDLREAEAKEQAIRRSMADLEITIA
TQSDALTEVVQAERDAEASRLLFENFQNRLRETSMQIGLQRADSRVISRAFPPDRPALPN
KGQILILSVFLGGFLGTVLVVVLQLSRARLHSAAQIAGLTSVPVIAVLDQFSQKIRPEQA
SALGPQTRDGEAIRNLRTTLLMARGDVPPQVVVFTSAESGDGKSTLSAAMAHNMAQIGKS
VLLVDGDLRRHYLSDPLADGNSKPGLFDVLSGRCDLAEAVLPGALGQADILPAGSVSGSA
ADLLSQGGLTALLSVARSHWDIIIFDTPPISVVPDARIIGQHADLLILLAQWNTTRQAVF
TDALRELEQGGRSPDGIVLTKVKAAAKPLYGATKRSRDRYYHG