Protein Info for PGA1_262p00060 in Phaeobacter inhibens DSM 17395

Annotation: putative glycosyl transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 196 to 217 (22 residues), see Phobius details PF13641: Glyco_tranf_2_3" amino acids 6 to 225 (220 residues), 39.8 bits, see alignment E=8.1e-14 PF00535: Glycos_transf_2" amino acids 9 to 127 (119 residues), 97.8 bits, see alignment E=1.1e-31 PF10111: Glyco_tranf_2_2" amino acids 34 to 225 (192 residues), 30.9 bits, see alignment E=3e-11

Best Hits

Predicted SEED Role

"FIG00918002: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7ESH5 at UniProt or InterPro

Protein Sequence (438 amino acids)

>PGA1_262p00060 putative glycosyl transferase (Phaeobacter inhibens DSM 17395)
MADPRPQVSVIMASRNAAAYLPLAIRAVLAQTLTDLELIIVDDASEDDSWAVIRAAVAAD
PRIRAQRRSHSGGPAIARNDALALARGEWVAICDSDDSQHPRRLELMLNAARDLAADVVA
DDMILFSGQPMARGATILGRHAPKAAQMLNLKDLVLSGVDPEGISHIGYLKPLIKKCFLN
DLRYDPRLRIGEDHDLYLRLVLAGAKMWVLPMAAYLYRRHVASTSYRNEPRDLTAQMGVL
DDLVQQQARADLAELAHVRRRALLRRHAQLELARDVRAGHLARALRRAVMRPDHLPWLAS
VLRNRMELKVQAAASRLWRRPQRWRLGGRSDGAGGVTLPMDADGALDLSAAAAPVWARMC
CEASRREVEAEAVDALGQSALWMVPTVRTLAAGASDVANGTRARCSACAMAGSAGSERVA
VESGGDQQQNAGQDDTDG