Protein Info for PGA1_c03710 in Phaeobacter inhibens DSM 17395

Annotation: Acyl dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF19315: MC_hydratase
  • amino acids 7 to 311 (305 residues), 49.1 bits, E=4.9e-17
• PF13452: MaoC_dehydrat_N
  • amino acids 43 to 140 (98 residues), 24.5 bits, E=2.7e-09

Best Hits

Swiss-Prot: 75% identical to MCH_RHOS4: Mesaconyl-CoA hydratase (mch) from Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)

KEGG orthology group: K14449, mesaconyl-CoA hydratase (inferred from 86% identity to sit:TM1040_3523)

MetaCyc: 75% identical to mesaconyl-CoA hydratase (Cereibacter sphaeroides)
RXN-8960 [EC: 4.2.1.148]

Predicted SEED Role

"Mesaconyl-CoA hydratase"

MetaCyc Pathways

• methylaspartate cycle (15/19 steps found)
• ethylmalonyl-CoA pathway (7/11 steps found)
• superpathway of the 3-hydroxypropanoate cycle (11/18 steps found)
• glyoxylate assimilation (7/13 steps found)
• crotonyl-CoA/ethylmalonyl-CoA/hydroxybutyryl-CoA cycle (engineered) (7/14 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.148

Sequence Analysis Tools

See I7EWB3 at UniProt or InterPro

Protein Sequence (343 amino acids)

>PGA1_c03710 Acyl dehydratase (Phaeobacter inhibens DSM 17395)
MAKTTPGRFFEDYAVGDVLHHAVPRTVSGGERALYHALYPARHALYSSDEFARGCGLLGA
PLEDLAAFHMVFGKTVPDVSLNAVANLGYAEGRWHLPVYAGDTLRAESEVIGVKQNSNGK
SGVVYVRTRGLNQRDDCVLDYVRWVMVRKGNLELPAPETCIPELTRVMPAEDLVIPKGLD
FSGYDFALAGEAHRWGDYEVGEQIDHIDGVTVEEAEHMLATRLWQNTAKVHFDTTARPDG
SRLIYGGHVISMARALSFNGLANAQMIVGLNGGAHANPCTAGMTIRAWSEVLDKAETSAP
GVGAIRLRLVATSGGAPFQLKGEDGKYRSEVLLDLDYWALMPL