Protein Info for PGA1_262p00030 in Phaeobacter inhibens DSM 17395

Annotation: Glycosyl hydrolases family 16./Hemolysin-type calcium-binding repeat (2 copies).

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 432 PF00722: Glyco_hydro_16" amino acids 39 to 221 (183 residues), 60.6 bits, see alignment E=1.4e-20 PF00353: HemolysinCabind" amino acids 260 to 294 (35 residues), 30.5 bits, see alignment 2.8e-11 amino acids 287 to 321 (35 residues), 33.7 bits, see alignment 2.8e-12 amino acids 295 to 330 (36 residues), 33.8 bits, see alignment 2.6e-12 amino acids 323 to 353 (31 residues), 18.8 bits, see alignment (E = 1.3e-07)

Best Hits

Predicted SEED Role

"Alkaline phosphatase (EC 3.1.3.1)" in subsystem Phosphate metabolism (EC 3.1.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.1

Use Curated BLAST to search for 3.1.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F4C9 at UniProt or InterPro

Protein Sequence (432 amino acids)

>PGA1_262p00030 Glycosyl hydrolases family 16./Hemolysin-type calcium-binding repeat (2 copies). (Phaeobacter inhibens DSM 17395)
MASTDSAQADVTPTVDLRIPGQVRDDDDWLVSTWNAGQSRDTKWSKDNVQINADGAVELH
LTSESGAGERTFTGGEMQSEAAHETGTWSWTAQAPQMQDGTVFGMFLYQEDYRNDRWLEF
DFEFAGANTRQVQLSIHMEAEDGSRVRLADGPAGPLVVDLGFDAAAGLHTYEIELTGTAA
IFRVDGEVLAELSGADMPGGLWYSGAVKSFADLWAVSDNQTAWAGTPDPDAPPLVAVIAD
VSLPGQEQEGTPNFATEQVGTDQAEDLFGGDGADLIHGGAGADQLVGNNGADHLYGDKGR
DILRGKDGDDFLFGGRGKDRLAGGGGEDVLDGGIGRDQLRGGGGADTFVFSQGGPADRVN
DFTLSHGDTLDLTRFNLNGAEQLRWLDGERGRGTRDLLQVEVDDGWINVAVIDDRAEALT
LDLLIAQDAILF