Protein Info for Psest_3663 in Pseudomonas stutzeri RCH2

Annotation: Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 223 PF00483: NTP_transferase" amino acids 2 to 141 (140 residues), 82.6 bits, see alignment E=3.6e-27 PF12804: NTP_transf_3" amino acids 3 to 108 (106 residues), 46.7 bits, see alignment E=4.1e-16

Best Hits

Swiss-Prot: 75% identical to MURU_PSEPK: N-acetylmuramate alpha-1-phosphate uridylyltransferase (murU) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K00966, mannose-1-phosphate guanylyltransferase [EC: 2.7.7.13] (inferred from 89% identity to psa:PST_0731)

MetaCyc: 75% identical to N-acetyl-alpha-D-muramate 1-phosphate uridylyltransferase (Pseudomonas putida KT2440)
RXN-18661 [EC: 2.7.7.99]

Predicted SEED Role

"Glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24)" in subsystem Rhamnose containing glycans or dTDP-rhamnose synthesis or linker unit-arabinogalactan synthesis (EC 2.7.7.24)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.24

Use Curated BLAST to search for 2.7.7.13 or 2.7.7.24 or 2.7.7.99

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GQ61 at UniProt or InterPro

Protein Sequence (223 amino acids)

>Psest_3663 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) (Pseudomonas stutzeri RCH2)
MKAMILAAGKGERLRPLTLHTPKPLVRAAGVPLIEYHVRALAAAGFDELVINHAWLGQQI
EDYLGDGQRFGVAIRYSAEGEPLETGGGIHRALGLLGDEPFLVVNGDIWTDYDFAQLRRP
LAGLAHLVLVDNPPHHPKGDFSLAESAVTEPEVSGDALTYSGISVLHPALFEGCQPGAFK
LAPLLRRAMADGQVSGECHAGLWVDVGTHERLAEVEQLLEARR