Protein Info for PGA1_c36500 in Phaeobacter inhibens DSM 17395

Annotation: enoyl-CoA hydratase/isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 PF00378: ECH_1" amino acids 10 to 258 (249 residues), 277.1 bits, see alignment E=1.3e-86 PF16113: ECH_2" amino acids 16 to 186 (171 residues), 118.9 bits, see alignment E=3.6e-38

Best Hits

Swiss-Prot: 63% identical to ECHA8_MYCTU: Probable enoyl-CoA hydratase echA8 (echA8) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K01692, enoyl-CoA hydratase [EC: 4.2.1.17] (inferred from 87% identity to sit:TM1040_3030)

MetaCyc: 84% identical to acryloyl-CoA hydratase (Ruegeria pomeroyi DSS-3)
RXN-6383 [EC: 4.2.1.116]

Predicted SEED Role

"Enoyl-CoA hydratase (EC 4.2.1.17)" in subsystem Acetyl-CoA fermentation to Butyrate or Butanol Biosynthesis or Isoleucine degradation or Polyhydroxybutyrate metabolism or Valine degradation or n-Phenylalkanoic acid degradation (EC 4.2.1.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.17

Use Curated BLAST to search for 4.2.1.116 or 4.2.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DW67 at UniProt or InterPro

Protein Sequence (258 amino acids)

>PGA1_c36500 enoyl-CoA hydratase/isomerase (Phaeobacter inhibens DSM 17395)
MAYETINVEVQDHVCQIKLNRPEALNALNSELLSELCTALEEADASDKVRCIILTGSEKA
FAAGADIKEMSDKSFTEVFSTNLFAGVNDRISAIRKPIIAAVAGYALGGGCELAMLCDFI
IAADTAKFGQPEINLGVIAGIGGTQRLTRFVGKSKSMDMNLTGRFMTAEEAERAGLVSRV
VPAKKLLDEATAAAHKIAEKSLLTAMAVKETVNRSYELPLSEGLLFERRVFHSMFATEDQ
KEGMAAFLEKREAQFRDK