Protein Info for PGA1_c36500 in Phaeobacter inhibens DSM 17395
Annotation: enoyl-CoA hydratase/isomerase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 63% identical to ECHA8_MYCTU: Probable enoyl-CoA hydratase echA8 (echA8) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
KEGG orthology group: K01692, enoyl-CoA hydratase [EC: 4.2.1.17] (inferred from 87% identity to sit:TM1040_3030)MetaCyc: 84% identical to acryloyl-CoA hydratase (Ruegeria pomeroyi DSS-3)
RXN-6383 [EC: 4.2.1.116]
Predicted SEED Role
"Enoyl-CoA hydratase (EC 4.2.1.17)" in subsystem Acetyl-CoA fermentation to Butyrate or Butanol Biosynthesis or Isoleucine degradation or Polyhydroxybutyrate metabolism or Valine degradation or n-Phenylalkanoic acid degradation (EC 4.2.1.17)
MetaCyc Pathways
- oleate β-oxidation (30/35 steps found)
- fatty acid salvage (6/6 steps found)
- adipate degradation (5/5 steps found)
- acrylate degradation II (3/3 steps found)
- benzoyl-CoA biosynthesis (3/3 steps found)
- superpathway of coenzyme A biosynthesis II (plants) (8/10 steps found)
- adipate biosynthesis (4/5 steps found)
- fatty acid β-oxidation I (generic) (5/7 steps found)
- 2-methyl-branched fatty acid β-oxidation (10/14 steps found)
- superpathway of glyoxylate cycle and fatty acid degradation (10/14 steps found)
- β-alanine biosynthesis II (4/6 steps found)
- L-isoleucine degradation I (4/6 steps found)
- pyruvate fermentation to butanol II (engineered) (4/6 steps found)
- 3-hydroxypropanoate cycle (9/13 steps found)
- 1-butanol autotrophic biosynthesis (engineered) (19/27 steps found)
- phenylacetate degradation I (aerobic) (6/9 steps found)
- valproate β-oxidation (6/9 steps found)
- fatty acid β-oxidation II (plant peroxisome) (3/5 steps found)
- fatty acid β-oxidation IV (unsaturated, even number) (3/5 steps found)
- glutaryl-CoA degradation (3/5 steps found)
- propanoyl-CoA degradation II (3/5 steps found)
- L-valine degradation I (5/8 steps found)
- pyruvate fermentation to hexanol (engineered) (7/11 steps found)
- methyl ketone biosynthesis (engineered) (3/6 steps found)
- propanoate fermentation to 2-methylbutanoate (3/6 steps found)
- superpathway of Clostridium acetobutylicum acidogenic fermentation (5/9 steps found)
- acrylate degradation I (2/5 steps found)
- superpathway of phenylethylamine degradation (6/11 steps found)
- 3-hydroxypropanoate/4-hydroxybutanate cycle (11/18 steps found)
- superpathway of the 3-hydroxypropanoate cycle (11/18 steps found)
- benzoyl-CoA degradation I (aerobic) (3/7 steps found)
- fatty acid β-oxidation VI (mammalian peroxisome) (3/7 steps found)
- pyruvate fermentation to butanoate (3/7 steps found)
- glyoxylate assimilation (7/13 steps found)
- glycerol degradation to butanol (9/16 steps found)
- benzoate biosynthesis III (CoA-dependent, non-β-oxidative) (1/5 steps found)
- pyruvate fermentation to butanol I (3/8 steps found)
- (8E,10E)-dodeca-8,10-dienol biosynthesis (5/11 steps found)
- 3-phenylpropanoate degradation (4/10 steps found)
- L-glutamate degradation V (via hydroxyglutarate) (4/10 steps found)
- benzoate biosynthesis I (CoA-dependent, β-oxidative) (3/9 steps found)
- superpathway of Clostridium acetobutylicum solventogenic fermentation (5/13 steps found)
- L-glutamate degradation VII (to butanoate) (4/12 steps found)
- gallate degradation III (anaerobic) (3/11 steps found)
- superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (7/17 steps found)
- L-tryptophan degradation III (eukaryotic) (5/15 steps found)
- (4Z,7Z,10Z,13Z,16Z)-docosapentaenoate biosynthesis (6-desaturase) (2/13 steps found)
- crotonate fermentation (to acetate and cyclohexane carboxylate) (4/16 steps found)
- docosahexaenoate biosynthesis III (6-desaturase, mammals) (2/14 steps found)
- benzoate fermentation (to acetate and cyclohexane carboxylate) (4/17 steps found)
- toluene degradation VI (anaerobic) (4/18 steps found)
- platensimycin biosynthesis (6/26 steps found)
- Spodoptera littoralis pheromone biosynthesis (3/22 steps found)
KEGG Metabolic Maps
- Benzoate degradation via CoA ligation
- Biosynthesis of plant hormones
- Biosynthesis of unsaturated fatty acids
- Butanoate metabolism
- Caprolactam degradation
- Fatty acid elongation in mitochondria
- Fatty acid metabolism
- Geraniol degradation
- Limonene and pinene degradation
- Lysine degradation
- Propanoate metabolism
- Tryptophan metabolism
- Valine, leucine and isoleucine degradation
- alpha-Linolenic acid metabolism
- beta-Alanine metabolism
Isozymes
Compare fitness of predicted isozymes for: 4.2.1.17
Use Curated BLAST to search for 4.2.1.116 or 4.2.1.17
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See I7DW67 at UniProt or InterPro
Protein Sequence (258 amino acids)
>PGA1_c36500 enoyl-CoA hydratase/isomerase (Phaeobacter inhibens DSM 17395) MAYETINVEVQDHVCQIKLNRPEALNALNSELLSELCTALEEADASDKVRCIILTGSEKA FAAGADIKEMSDKSFTEVFSTNLFAGVNDRISAIRKPIIAAVAGYALGGGCELAMLCDFI IAADTAKFGQPEINLGVIAGIGGTQRLTRFVGKSKSMDMNLTGRFMTAEEAERAGLVSRV VPAKKLLDEATAAAHKIAEKSLLTAMAVKETVNRSYELPLSEGLLFERRVFHSMFATEDQ KEGMAAFLEKREAQFRDK