Protein Info for PGA1_c36460 in Phaeobacter inhibens DSM 17395

Annotation: putative lytic murein transglycosylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 464 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details TIGR02283: lytic murein transglycosylase" amino acids 95 to 390 (296 residues), 377.9 bits, see alignment E=1.7e-117 PF13406: SLT_2" amino acids 96 to 387 (292 residues), 387.6 bits, see alignment E=3.6e-120 PF01471: PG_binding_1" amino acids 409 to 463 (55 residues), 52.2 bits, see alignment 5.8e-18

Best Hits

KEGG orthology group: None (inferred from 59% identity to sit:TM1040_2991)

Predicted SEED Role

"Membrane-bound lytic murein transglycosylase B precursor (EC 3.2.1.-)" in subsystem Peptidoglycan Biosynthesis (EC 3.2.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F235 at UniProt or InterPro

Protein Sequence (464 amino acids)

>PGA1_c36460 putative lytic murein transglycosylase (Phaeobacter inhibens DSM 17395)
MQYDLGARRHIALTAAMLAALAATDARVAASPLPTADGPLVEIAASQPPQVSLRPTARPV
APSGVAATPLRPRIRPEQQAPAPAEPGVSPAKQRAFEGWIAAFRPRARAEGLSQATLDRA
LSGVEFDPKIVQRDGNQSEFVTPIWTYLERAVSDARIQNGKAALRDHAQTLARIEAKYGV
DREVVAAVWGMESNYGTFRGERDIIRSLATLAFDGRRGAFFESQLIAALQILQAGDVTPE
AMTGSWAGAMGHTQFMPTSYLAYAVDFTGDGKRDIWSDDPADALASTAAYLKRFGWVKDQ
PWGLEVRLPTGFNYALADRKIIKSAQAWRQLGVTSADGGSLPDHGKGALLLPAGAQGAAF
IVYRNFAVIERYNAADAYVIGVGHLSDRLRGTGPIRASWPQDSRPLTYKERRELQQRLTG
AGYGTGGADGRIGPKTRAALRAYQLAMGLTPDGYPSLSVLNRLR