Protein Info for HP15_3532 in Marinobacter adhaerens HP15

Annotation: Metal-dependent phosphohydrolase, HD subdomain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 390 PF11871: DUF3391" amino acids 2 to 102 (101 residues), 34.7 bits, see alignment E=4.9e-12 TIGR00277: HDIG domain" amino acids 135 to 225 (91 residues), 36.4 bits, see alignment E=1.9e-13 PF01966: HD" amino acids 135 to 257 (123 residues), 75 bits, see alignment E=1.2e-24 PF13487: HD_5" amino acids 142 to 288 (147 residues), 112.8 bits, see alignment E=3.1e-36

Best Hits

KEGG orthology group: None (inferred from 71% identity to maq:Maqu_3785)

Predicted SEED Role

"metal dependent phosphohydrolase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PG32 at UniProt or InterPro

Protein Sequence (390 amino acids)

>HP15_3532 Metal-dependent phosphohydrolase, HD subdomain protein (Marinobacter adhaerens HP15)
MSLDRPWTQVPVLFQGFTLTDDNQAQILRQYCEWVLVEDEESHLNPVLDQISLLKRRTSE
PLPETCSLQQELPRAHATWSRTQAFVEEVTRQIEAGNDLNLQSARPIIRECVDSVKANAS
AMFWMSRIKSRDAYTAEHCLRVAIFCVAFARFLGMPDDDLETVGMCGLLHDLGKLRVPDE
ILNKPGALTPEEHSIMRQHTTLGYELLRADANLDPIISDVSRHHHERMDGRGYPEQLAEW
QISRFARLVSIVDAFDAITSDRCYRDGLPASEAIRILFRNRGQQFDASMVEAFIRMIGVY
PPGSLVELSTGEVAIVLATHPRRKLKPKVEVLLNGDKQPVTPRIIDLGGTGSEPDEGSPE
IARPVSDGAFGVSLRDRIKQLMAVADRNAS