Protein Info for Psest_3656 in Pseudomonas stutzeri RCH2

Annotation: ABC-type spermidine/putrescine transport system, permease component I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 417 transmembrane" amino acids 35 to 56 (22 residues), see Phobius details amino acids 203 to 225 (23 residues), see Phobius details amino acids 234 to 257 (24 residues), see Phobius details amino acids 286 to 306 (21 residues), see Phobius details amino acids 338 to 358 (21 residues), see Phobius details amino acids 382 to 409 (28 residues), see Phobius details PF00528: BPD_transp_1" amino acids 218 to 409 (192 residues), 40.9 bits, see alignment E=9.3e-15

Best Hits

KEGG orthology group: K02054, putative spermidine/putrescine transport system permease protein (inferred from 98% identity to psa:PST_0738)

Predicted SEED Role

"Spermidine Putrescine ABC transporter permease component PotB (TC 3.A.1.11.1)" in subsystem Polyamine Metabolism (TC 3.A.1.11.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GS50 at UniProt or InterPro

Protein Sequence (417 amino acids)

>Psest_3656 ABC-type spermidine/putrescine transport system, permease component I (Pseudomonas stutzeri RCH2)
MATAISLPANEIAEPNLKQRLARAERVNKLKSQALILPLLLFVLLTFLVPIASLLWRSVE
NPEVVNTLPRTLAALAEWDGRGLPADPAYQALAEDLYQARREQSLGDLSKRLNMELAGYR
SLLTKTARAMPFRETPASYQEALEALDERWGDPAFWQVIQRNDSAVTGYYLLAALDHRID
ELGELAKVSPDQAVYLDIFARTFWMGLVITVICLLLAYPLAYLLANLPARQSNLLMILVL
LPFWTSILVRVAAWIVLLQSGGLINGALLKMGLIDEPLQLVFNRTGVYIAMVHILLPFMI
LPIYSVMKNISPSYMRAAVSLGCHPFASFWRVYFPQTLAGVGAGCLLVFIISIGYYITPA
LLGSPNDQMVSYFVAFYTNTTINWGMATALGGLLLLATMLLYVIYSWLVGASRLRLG