Protein Info for PGA1_c36430 in Phaeobacter inhibens DSM 17395

Annotation: putative ribonuclease R

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 756 TIGR02063: ribonuclease R" amino acids 5 to 709 (705 residues), 671.3 bits, see alignment E=1.7e-205 TIGR00358: VacB and RNase II family 3'-5' exoribonucleases" amino acids 112 to 696 (585 residues), 486.1 bits, see alignment E=1.6e-149 PF17876: CSD2" amino acids 158 to 231 (74 residues), 38.9 bits, see alignment E=1.1e-13 PF00773: RNB" amino acids 249 to 576 (328 residues), 328.2 bits, see alignment E=9.3e-102 PF00575: S1" amino acids 627 to 694 (68 residues), 32.8 bits, see alignment E=1.1e-11

Best Hits

KEGG orthology group: K12573, ribonuclease R [EC: 3.1.-.-] (inferred from 82% identity to sit:TM1040_2994)

Predicted SEED Role

"3'-to-5' exoribonuclease RNase R" in subsystem RNA processing and degradation, bacterial

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E637 at UniProt or InterPro

Protein Sequence (756 amino acids)

>PGA1_c36430 putative ribonuclease R (Phaeobacter inhibens DSM 17395)
MTRIPSKAEILDWIAAHPTHTSKRDIAKAFGIKGSDRIDLKRILKELEAEGHLEKRKKTY
RDPERLPPVSVLQIKAPDGDGDLFARPLEWHGEGVEPVVLVMPRASDPALGEGDRILARL
TVVQDAEYHYEARLIRRIGTNPRRVIGIFRKGDEGGRIVPIDKSASTEWAVAENATHGAR
DGELVEAEQAGPKSRLGLPRARVVERLGDPSAPKAVSLIAIHQHGILDHFPDEVIAEADA
AKPMGLKGREDLRDLPLITIDPADARDHDDACYAHADDDPKNPGGHVIWVAIADVAAYVQ
PGSALDRAARKRGNSSYFPDRVVPMLPDRLSGDLCSLHEGVPRACVAVRMQIDADGNKIA
HRFVRGLMRSAASLHYAEVQEAMDGAPTDRTGPFLEPVIKPLYAAYAALVKARAERQPLD
LDLPERKIVLDEKGTVASVNFRDRLDAHKLIEEFMVLANVAAAETLIKKRTPLLFRVHEE
PSPEKLEALRETARAAGLALAKGQVLQTRHLNALLHGAAGTDDAELINISTLRSMQQAYY
GPENFGHFGLALRNYAHFTSPIRRYADLIVHRALITAHGWGDDGLDTAEIERLEQTATHI
SETERRSMMAERDTTDRYLAAYLAERVGNEFEGRISGIARFGAFVKLDETGADGLVPVRS
IGREFFHFDAEAGTLMGADTGLIIAIGQRVKVRLAQATPVTGGLELELLSIEDKPMPAGG
GGGRRSPAGRSVKRKSAKAKAKRSKIKRKVERKRRS