Protein Info for HP15_3530 in Marinobacter adhaerens HP15

Annotation: D-erythro-7,8-dihydroneopterin triphosphate 2'-epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00526: FolB domain
  • amino acids 10 to 121 (112 residues), 109.1 bits, E=8.1e-36
• PF02152: FolB
  • amino acids 12 to 120 (109 residues), 89.5 bits, E=1.1e-29

Best Hits

Swiss-Prot: 61% identical to FOLX_SHIFL: Dihydroneopterin triphosphate 2'-epimerase (folX) from Shigella flexneri

KEGG orthology group: K07589, D-erythro-7,8-dihydroneopterin triphosphate epimerase [EC: 5.-.-.-] (inferred from 86% identity to maq:Maqu_3783)

MetaCyc: 61% identical to dihydroneopterin triphosphate 2'-epimerase (Escherichia coli K-12 substr. MG1655)
H2NTPEPIM-RXN [EC: 5.1.99.7]

Predicted SEED Role

"Dihydroneopterin triphosphate epimerase" in subsystem Folate Biosynthesis

MetaCyc Pathways

• tetrahydromonapterin biosynthesis (3/4 steps found)

KEGG Metabolic Maps

• Biosynthesis of steroids
• Carotenoid biosynthesis - General
• Lipopolysaccharide biosynthesis
• Pentose and glucuronate interconversions

Isozymes

Compare fitness of predicted isozymes for: 5.-.-.-

Use Curated BLAST to search for 5.-.-.- or 5.1.99.7

Sequence Analysis Tools

See E4PG30 at UniProt or InterPro

Protein Sequence (124 amino acids)

>HP15_3530 D-erythro-7,8-dihydroneopterin triphosphate 2'-epimerase (Marinobacter adhaerens HP15)
MTDVNGNHLAKVRIKDLLLRAYIGIKEEEINNQQDVLINVALTYDATEAVNQNEISAALN
YRTITKQIIHHVDGNRFALLERLTHEVLTIVMEHEAVKWAEVEIDKPHALRYAESVSVCL
QAHR