Protein Info for PGA1_c36420 in Phaeobacter inhibens DSM 17395

Annotation: succinyl-diaminopimelate desuccinylase DapE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 385 TIGR01246: succinyl-diaminopimelate desuccinylase" amino acids 10 to 379 (370 residues), 382.1 bits, see alignment E=1.4e-118 PF04389: Peptidase_M28" amino acids 53 to 149 (97 residues), 22.3 bits, see alignment E=1.5e-08 PF01546: Peptidase_M20" amino acids 69 to 379 (311 residues), 132.7 bits, see alignment E=2.6e-42 PF07687: M20_dimer" amino acids 180 to 285 (106 residues), 79.4 bits, see alignment E=2.9e-26

Best Hits

Swiss-Prot: 79% identical to DAPE_RUEPO: Succinyl-diaminopimelate desuccinylase (dapE) from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)

KEGG orthology group: K01439, succinyl-diaminopimelate desuccinylase [EC: 3.5.1.18] (inferred from 79% identity to sil:SPO3332)

Predicted SEED Role

"N-succinyl-L,L-diaminopimelate desuccinylase (EC 3.5.1.18)" in subsystem Arginine Biosynthesis extended or Lysine Biosynthesis DAP Pathway (EC 3.5.1.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7ESG0 at UniProt or InterPro

Protein Sequence (385 amino acids)

>PGA1_c36420 succinyl-diaminopimelate desuccinylase DapE (Phaeobacter inhibens DSM 17395)
MTHSPLDPQQLTADLIRCASVTPEEGGALVLLDKVLSAAGFTCTRVDRGEVSNLIARWGD
KGHPRTMGFNGHTDVVPVGDTNAWTVDPFGAEEKDGFLYGRGATDMKSGVAAFVAAAIDL
VQTTPPDGAILLTITGDEEGDAIDGTTALLDHMDREGEQMAVCLVGEPTCPDKMGEMIKI
GRRGSLSAWFTVTGVQGHSAYPHRAKNPLNAMVRLMDRLASHELDQGTEHFDASTLAVVT
IDTGNPATNVIPAQTRSTVNIRFNDAHTGAELSDWLRAEAARAAKDFGVDIAVEIKVSGE
SFITPPGPLSDLVSAAVETETGRKPQLSTTGGTSDARFVKNHCPVVEVGLVGKTMHQVDE
RVEIAQIHQLKSIYGRILRDYFDQN