Protein Info for PGA1_c36390 in Phaeobacter inhibens DSM 17395

Annotation: putative ABC transporter extracellular solute-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 351 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 130 to 153 (24 residues), see Phobius details amino acids 168 to 185 (18 residues), see Phobius details amino acids 197 to 219 (23 residues), see Phobius details PF10613: Lig_chan-Glu_bd" amino acids 23 to 114 (92 residues), 45 bits, see alignment E=1.7e-15 PF00497: SBP_bac_3" amino acids 28 to 349 (322 residues), 95.6 bits, see alignment E=3.1e-31 PF00060: Lig_chan" amino acids 140 to 240 (101 residues), 43.7 bits, see alignment E=3.7e-15

Best Hits

KEGG orthology group: None (inferred from 63% identity to sit:TM1040_2998)

Predicted SEED Role

"Glutamine ABC transporter, periplasmic glutamine-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F4B7 at UniProt or InterPro

Protein Sequence (351 amino acids)

>PGA1_c36390 putative ABC transporter extracellular solute-binding protein (Phaeobacter inhibens DSM 17395)
MRRFFAPFVLIYLLWGLAATAETLTVSTVTRPPFSMMEGDRETGFSIDLVRSLTDRLGWD
YQLVRTDTFGEMLEMVRTGEVDMAAANISITAARETDMDFSHPIFESGLRIMVAAADVRA
PSLIRVLFSADLMIAIAIAVVLLMGGGMLMWGLERRAQPYFDRPLKEAWFPSFWWALNLV
VNGGFEERVPRTPIGRIFGVILVVSSLFVVSLFVAKITAVMTVEAISGSINSVNDLYDKD
VGTLADSTAARFLERRDISYRGFSDLASLLSDFESGNTRVVVFDAPVLDHYMEDNGRLHG
RAVGQVFLREDYGLLLPDGSPHLEEINRALLALRENGEYGDIYRKWFGKAP