Protein Info for Psest_3643 in Pseudomonas stutzeri RCH2

Annotation: Diadenosine tetraphosphate (Ap4A) hydrolase and other HIT family hydrolases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF11969: DcpS_C
  • amino acids 3 to 106 (104 residues), 81.2 bits, E=7.9e-27
• PF01230: HIT
  • amino acids 12 to 107 (96 residues), 91.4 bits, E=5e-30

Best Hits

Swiss-Prot: 52% identical to HINT1_HUMAN: Histidine triad nucleotide-binding protein 1 (HINT1) from Homo sapiens

KEGG orthology group: K02503, Hit-like protein involved in cell-cycle regulation (inferred from 81% identity to pae:PA0656)

MetaCyc: 47% identical to purine nucleoside phosphoramidase (Escherichia coli K-12 substr. MG1655)
3.9.1.-

Predicted SEED Role

"Bis(5'-nucleosyl)-tetraphosphatase (asymmetrical) (EC 3.6.1.17)" (EC 3.6.1.17)

KEGG Metabolic Maps

• Purine metabolism
• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.17

Use Curated BLAST to search for 3.6.1.17

Sequence Analysis Tools

See L0GQ43 at UniProt or InterPro

Protein Sequence (113 amino acids)

>Psest_3643 Diadenosine tetraphosphate (Ap4A) hydrolase and other HIT family hydrolases (Pseudomonas stutzeri RCH2)
MDCLFCKIVCGDIPAHKFYEDDQVIAFHDISAQAPVHFLVIPKKHIATLNDLSEENDKLL
AGHILFTAQRLAQEQGCQDGFRVVMNCNDLGGQTVHHIHMHVLGQRQMHWPPG