Protein Info for Psest_3641 in Pseudomonas stutzeri RCH2

Annotation: Predicted membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 transmembrane" amino acids 184 to 206 (23 residues), see Phobius details amino acids 212 to 232 (21 residues), see Phobius details amino acids 244 to 265 (22 residues), see Phobius details amino acids 287 to 310 (24 residues), see Phobius details PF05656: DUF805" amino acids 174 to 275 (102 residues), 69.6 bits, see alignment E=1.6e-23

Best Hits

KEGG orthology group: None (inferred from 68% identity to psa:PST_0752)

Predicted SEED Role

"FIG00954311: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GS35 at UniProt or InterPro

Protein Sequence (318 amino acids)

>Psest_3641 Predicted membrane protein (Pseudomonas stutzeri RCH2)
MQEAHFKIVFNGELMPDMPVETVKSNLARLFKTDASKVERLFGGQDAVIKTRLSQQDADK
YLAALHRAGAKARKEPERAVPALSLVQTEEERSAAESERAAASVMTCPKCGHIQSQSSEC
TACGIIIEKYLARQAQLRDASAMQGKSTIQSPYAPPSADVNETMPLHGELKPLSISGRIG
RLRYLAWSLVVMLTATGLFAIAALLMPISSTLGFVCVAVVGIGMLVVSVQIGVQRLHDFG
WSGWLILLNLVPLLGSLFPFFMLLMPGNREVNRYGSPPPPNSRSVKVLAALWLVLIIFGL
VAALTVPALVDMRRGAAL