Protein Info for Psest_3638 in Pseudomonas stutzeri RCH2

Annotation: Iron-sulfur cluster assembly accessory protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 116 TIGR00049: iron-sulfur cluster assembly accessory protein" amino acids 11 to 115 (105 residues), 128.1 bits, see alignment E=7.6e-42 PF01521: Fe-S_biosyn" amino acids 11 to 111 (101 residues), 70.1 bits, see alignment E=9.5e-24

Best Hits

Swiss-Prot: 99% identical to ERPA_PSEU5: Iron-sulfur cluster insertion protein ErpA (erpA) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: None (inferred from 99% identity to psa:PST_0755)

Predicted SEED Role

"probable iron binding protein from the HesB_IscA_SufA family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GQ41 at UniProt or InterPro

Protein Sequence (116 amino acids)

>Psest_3638 Iron-sulfur cluster assembly accessory protein (Pseudomonas stutzeri RCH2)
MSVESFTPTAIQFSQGAASKVKSLVDEEGNPRLKLRVFVTGGGCSGFQYGFTFDEDVADD
DTIIEREGVSLVVDPMSYQYLAGAEVDYQEGLEGSRFVIKNPNATTTCGCGQSFSI