Protein Info for PGA1_c03680 in Phaeobacter inhibens DSM 17395

Updated annotation (from data): (3S)-malyl-CoA thioesterase [EC:3.1.2.30]
Rationale: Specifically important for: L-Threonine; Potassium acetate. This is part of the ethylmalonyl-CoA cycle for acetate assimilation, and hence is important on threonine (cleaved to glycine and acetate via the PGA1_c34330 or kbl) and acetate (where it has a milder phenotype). The annotation of sit:TM1040_3520 has been updated to (3S)-malyl-CoA thioesterase [EC:3.1.2.30]. 69% similar to MCTE_RHOS4 (consistent with the KEGG annotation). SEED suggests that this is the malyl-CoA/methylmalyl-CoA lyase but that activity is probably provided by PGA1_c30490. (KEGG_correct)
Original annotation: putative citrate lyase subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03328: HpcH_HpaI
  • amino acids 9 to 216 (208 residues), 136 bits, E=1.2e-43
• PF15617: C-C_Bond_Lyase
  • amino acids 175 to 278 (104 residues), 30.7 bits, E=1.9e-11

Best Hits

Swiss-Prot: 69% identical to MCTE_RHOSK: (3S)-malyl-CoA thioesterase (mcl2) from Rhodobacter sphaeroides (strain KD131 / KCTC 12085)

KEGG orthology group: K14451, (3S)-malyl-CoA thioesterase (inferred from 86% identity to sit:TM1040_3520)

Predicted SEED Role

"L-malyl-CoA/beta-methylmalyl-CoA lyase (EC 4.1.3.-)" (EC 4.1.3.-)

MetaCyc Pathways

• methylaspartate cycle (15/19 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Pyruvate metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.1.3.-

Use Curated BLAST to search for 3.1.2.30 or 4.1.3.-

Sequence Analysis Tools

See I7ETR9 at UniProt or InterPro

Protein Sequence (284 amino acids)

>PGA1_c03680 (3S)-malyl-CoA thioesterase [EC:3.1.2.30] (Phaeobacter inhibens DSM 17395)
MDPRIRPYRSVLYIPGSKLRALEKARSLPVDAIIFDLEDAVSAEEKVNARQTLEEALRAG
GYGARMKIVRINGLDTVWGRADAAAAARMDCDAILLPKVSSPEDLDALAVITGDKPLWAM
METPRGMLNAAAIAAHPLLQGMVMGTNDLAKELQTRFRPDRLPLMAGLGQCLLAAKAKGI
IIVDGVYNAFKDAEGLEAECDQGRDMGFDGKTLIHPAQVDVANSAFAPSEDEIDLARRQI
AAFDAAEAEGQGVAVVDGKIVENLHVATAREILAKADAIAAVSA