Protein Info for Psest_3636 in Pseudomonas stutzeri RCH2

Annotation: Membrane proteins related to metalloendopeptidases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 469 signal peptide" amino acids 1 to 40 (40 residues), see Phobius details PF04225: LysM_OapA" amino acids 106 to 183 (78 residues), 33 bits, see alignment E=8e-12 PF19425: Csd3_N2" amino acids 199 to 317 (119 residues), 53.3 bits, see alignment E=4.2e-18 PF01551: Peptidase_M23" amino acids 330 to 426 (97 residues), 118 bits, see alignment E=2.5e-38

Best Hits

KEGG orthology group: None (inferred from 88% identity to psa:PST_0757)

Predicted SEED Role

"Peptidase, M23/M37 family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GS30 at UniProt or InterPro

Protein Sequence (469 amino acids)

>Psest_3636 Membrane proteins related to metalloendopeptidases (Pseudomonas stutzeri RCH2)
MPSKSKAPNYPKSHLLAASGVAALLSLALLVFPSREVEAKKTFIDLKLETSSGQIIIEPD
QKESTLAQSPFSSASQLEPSAEAQHEMLPEADAGQETSAAEDPLTKTVVVANGDTLSTVF
AKVGLSPSVMHAVLASSQDAKQLSRLKIGQALEFKLTENGELANLRSKLNSLETLALEKT
ADGYAFKKEQVKPEVTSVYARGEIDSSLFLAAKRAGLSHNLTMDLANVFGYDIDFALDIR
KGDSFEVIYEEKTVEGERVGTGNILAARFTNRGKTYSAVRYTSKDGATSYYNADGTSMRK
AFIRTPVDFARISSRFSNGRKHPILNKIRAHKGVDYAAPHGTPIKSAGDGKVLLAGRKGG
YGNTVIIQHGQRYRTLYAHMQGFAKGVRNGSTVKQGQIIGYIGTTGLSTGPHLHYEFQVD
GVHVDPLGLKLPMADPIAQNEKQRFMQLSQPLMARMDEEKATMLALNQQ