Protein Info for Psest_3635 in Pseudomonas stutzeri RCH2

Annotation: tyrosyl-tRNA synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 TIGR00234: tyrosine--tRNA ligase" amino acids 3 to 396 (394 residues), 391.4 bits, see alignment E=2.7e-121 PF00579: tRNA-synt_1b" amino acids 31 to 311 (281 residues), 285.7 bits, see alignment E=2.2e-89

Best Hits

Swiss-Prot: 86% identical to SYY_PSEPF: Tyrosine--tRNA ligase (tyrS) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K01866, tyrosyl-tRNA synthetase [EC: 6.1.1.1] (inferred from 92% identity to psa:PST_0758)

Predicted SEED Role

"Tyrosyl-tRNA synthetase (EC 6.1.1.1)" (EC 6.1.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GMZ9 at UniProt or InterPro

Protein Sequence (401 amino acids)

>Psest_3635 tyrosyl-tRNA synthetase (Pseudomonas stutzeri RCH2)
MKSVEEQLSVIKRGADEVLVESELVAKLERGEPLRVKAGFDPTAPDLHLGHTVLINKMRQ
LQELGHQVIFLIGDFTGMIGDPSGKSATRPPLTRDQVLENAETYKAQVFKILDPARTEVA
FNSTWMDKLTPADFIRLASQYTVARMLERDDFHKRYSTNQPIAIHEFLYPLVQGYDSVAL
KADIELGGTDQKFNLLMGRELQRAYGQASQCVVTMPLLEGLDGVKKMSKSLGNYVGIQEL
PGVMYSKLVSIPDALMWRYFELLSFRAQAEIDELRLDVERGANPRDIKIKLAEEIVARFH
GEEAAAAAHRSAGNRMKDGELPEDLPEIELTSDQGMPIASVLNKAALVKNAAVARDLLGS
GGVRVDGQVVDRGFIFQLGATHVCQAGKKAFARVTLKPEQN