Protein Info for HP15_3509 in Marinobacter adhaerens HP15

Annotation: Holliday junction resolvase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00250: putative transcription antitermination factor YqgF
  • amino acids 1 to 129 (129 residues), 145.3 bits, E=5.5e-47
• PF03652: RuvX
  • amino acids 1 to 131 (131 residues), 137.4 bits, E=2e-44

Best Hits

Swiss-Prot: 84% identical to YQGF_MARHV: Putative pre-16S rRNA nuclease (Maqu_3763) from Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8)

KEGG orthology group: K07447, putative holliday junction resolvase [EC: 3.1.-.-] (inferred from 84% identity to maq:Maqu_3763)

MetaCyc: 53% identical to ribonuclease H-like domain-containing nuclease (Escherichia coli K-12 substr. MG1655)
Exodeoxyribonuclease I. [EC: 3.1.11.1]

Predicted SEED Role

"Putative Holliday junction resolvase YqgF"

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-, 3.1.11.1

Use Curated BLAST to search for 3.1.-.- or 3.1.11.1

Sequence Analysis Tools

See E4PG09 at UniProt or InterPro

Protein Sequence (131 amino acids)

>HP15_3509 Holliday junction resolvase (Marinobacter adhaerens HP15)
MAFDFGTRRIGVAVGQELLGSGQPVALIPARDGIPDWQQIESLLEEWRPDLVVVGLPLNM
DDTENDMCARARKFGKRLHGRYHVPVEMVDERLTSFEAKGEVMAAGGSRDFGRHGVDDRA
AVLILETFFQQ