Protein Info for HP15_3501 in Marinobacter adhaerens HP15

Annotation: integral membrane protein, possible transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 687 transmembrane" amino acids 13 to 31 (19 residues), see Phobius details amino acids 152 to 172 (21 residues), see Phobius details amino acids 185 to 204 (20 residues), see Phobius details amino acids 222 to 242 (21 residues), see Phobius details amino acids 261 to 288 (28 residues), see Phobius details amino acids 298 to 321 (24 residues), see Phobius details amino acids 334 to 364 (31 residues), see Phobius details amino acids 376 to 403 (28 residues), see Phobius details amino acids 415 to 434 (20 residues), see Phobius details amino acids 455 to 476 (22 residues), see Phobius details amino acids 487 to 504 (18 residues), see Phobius details amino acids 533 to 553 (21 residues), see Phobius details amino acids 573 to 603 (31 residues), see Phobius details amino acids 612 to 629 (18 residues), see Phobius details amino acids 664 to 686 (23 residues), see Phobius details PF06808: DctM" amino acids 259 to 682 (424 residues), 63.7 bits, see alignment E=7.3e-22

Best Hits

KEGG orthology group: None (inferred from 89% identity to maq:Maqu_3756)

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, large permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PG01 at UniProt or InterPro

Protein Sequence (687 amino acids)

>HP15_3501 integral membrane protein, possible transporter (Marinobacter adhaerens HP15)
MSKGGFHRSGLEWFSSLPACLLLLAVVIFSTSSDIHNQMLRGGEQLWSGYYKLRMDPVQP
TCDPTRDIDAAVAEEMAADAETDDPMAALLGAEEKDPADVRLAIERAVADCREAHQNFEN
LSEQLTPGVKAYRAIELFIADLIAFGLESQRFILVILVMLCAVTATLTRHHIAMRAMETR
LDYTVSHTLQTIANAMLLGSSAIFRQSSLGSDTAVSSEELLLHNFWIIGFACLTLASLYR
LFRVPDDLEEGGSLNKAFLAVPLYTVMCLISGTYFALIGHASGIGIYLGKMMELSDMFLN
VGLYVWVGMMLKQTRLATLVFNVFRPWRMPPEMLAVVAVLVAAVPTAYTGASGIFVIAAG
AVIYSELRAAGARRHLALAATAMSGSLGVVLRPCLLVVVIAYLNREVTTDELFGWGIWVF
VLTATMFAIVALSVNRQSEFNLAPSAEAFPAMTQALKPLIPYVLVIAAVVLFYRLALDVS
MDEFSAPRLLPVIMLAILVYEHVSLKNRSGKASGEINHQGLERSLRGATNDTTAEIGALL
LLLGLSVSIGGVIERAHLMEAFPQSFDSAWSAMLLMVVILVILGMIMDAFGAVILVTATV
ATIAYSSGIHPIHFWMVTLVAFELGYLSPPVALNHLLTRQVVGEAEVLAAQQETGTFYQR
HERIIMPLIAMGISLVLVAFIPLIFYA