Protein Info for PGA1_c36060 in Phaeobacter inhibens DSM 17395

Annotation: putative NAD dependent epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 PF05368: NmrA" amino acids 1 to 125 (125 residues), 35.6 bits, see alignment E=2.8e-12 PF00106: adh_short" amino acids 3 to 87 (85 residues), 25.7 bits, see alignment E=2.7e-09 PF01370: Epimerase" amino acids 5 to 212 (208 residues), 68.7 bits, see alignment E=1.9e-22 PF04321: RmlD_sub_bind" amino acids 5 to 226 (222 residues), 50.2 bits, see alignment E=7.3e-17 PF01073: 3Beta_HSD" amino acids 7 to 119 (113 residues), 36.5 bits, see alignment E=1e-12 amino acids 125 to 200 (76 residues), 23.5 bits, see alignment E=9.5e-09 PF13460: NAD_binding_10" amino acids 9 to 148 (140 residues), 50.9 bits, see alignment E=6.2e-17

Best Hits

KEGG orthology group: K00329, NADH dehydrogenase [EC: 1.6.5.3] K00356, NADH dehydrogenase [EC: 1.6.99.3] (inferred from 78% identity to sit:TM1040_2820)

Predicted SEED Role

"NAD-dependent epimerase/dehydratase"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3, 1.6.99.3

Use Curated BLAST to search for 1.6.5.3 or 1.6.99.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E5X3 at UniProt or InterPro

Protein Sequence (329 amino acids)

>PGA1_c36060 putative NAD dependent epimerase (Phaeobacter inhibens DSM 17395)
MSKLVTIYGGSGFVGRYIARRMAKEGWRVRVAVRRPNEAMYVKPYGVPGQVEPVLCNIRD
DASVAAVMQGADAVVNCVGILNELGKNTFDAVQADGADRIARIAADQGVSTMVHVSAIGA
DQDSDSAYAQSKAAGETAVLTHMPEAVILRPSIIFGAEDQFFNRFAAMTRLSPVLPIAHA
DTKFQPVYVDDVAKAAVAALLGQAKPGVYELGGPEVKSFGALMQQMLEVIDRRRLVLSLP
GPIAKLVALGFDVMQFVSFQLIENKMLTRDQLKNLEADNVVSDGAKGFDELGIRPVSLAS
VLPDYLWKFRPSGQYNELMDSARNLRNDL