Protein Info for PGA1_c03660 in Phaeobacter inhibens DSM 17395

Annotation: Predicted permeases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 37 to 61 (25 residues), see Phobius details amino acids 75 to 94 (20 residues), see Phobius details amino acids 100 to 118 (19 residues), see Phobius details amino acids 135 to 153 (19 residues), see Phobius details amino acids 173 to 193 (21 residues), see Phobius details amino acids 200 to 222 (23 residues), see Phobius details amino acids 229 to 247 (19 residues), see Phobius details PF01925: TauE" amino acids 13 to 245 (233 residues), 111.9 bits, see alignment E=2.1e-36

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 63% identity to rde:RD1_1618)

Predicted SEED Role

"INTEGRAL MEMBRANE PROTEIN (Rhomboid family)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EWA8 at UniProt or InterPro

Protein Sequence (251 amino acids)

>PGA1_c03660 Predicted permeases (Phaeobacter inhibens DSM 17395)
MPEITVMFFLVAVLAITFAGVSKAGFGSGAAFASSSILALIVEPGVALAFMLPLLMLIDV
ASLRPYWGRWRLRESLLLILGGLPGVALGAVFYKSVDADAMRILIGVISVAFVAWQLSGR
LRARLAKPREKADVTGIVAGVVAGFTSFVSHAGGPPAAVYLLGRNMSKTEYQASTVLVFG
ILNAAKFVPYAMLGMVTPASLTLDLMLAPFALLGAWIGVRLHHRVSEPVFFGLTYVLLVT
TGTKLIWDGLT