Protein Info for Psest_3608 in Pseudomonas stutzeri RCH2

Annotation: translation elongation factor TU

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 397 TIGR00485: translation elongation factor Tu" amino acids 1 to 397 (397 residues), 745.6 bits, see alignment E=1e-228 PF00009: GTP_EFTU" amino acids 10 to 204 (195 residues), 211.3 bits, see alignment E=1.4e-66 TIGR00231: small GTP-binding protein domain" amino acids 13 to 146 (134 residues), 50 bits, see alignment E=2.8e-17 PF03144: GTP_EFTU_D2" amino acids 228 to 297 (70 residues), 65.5 bits, see alignment E=7.1e-22 PF03143: GTP_EFTU_D3" amino acids 301 to 395 (95 residues), 139.7 bits, see alignment E=6.2e-45

Best Hits

Swiss-Prot: 98% identical to EFTU2_PSEU5: Elongation factor Tu 2 (tuf2) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: None (inferred from 99% identity to pfv:Psefu_0638)

Predicted SEED Role

"Translation elongation factor Tu" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GQ24 at UniProt or InterPro

Protein Sequence (397 amino acids)

>Psest_3608 translation elongation factor TU (Pseudomonas stutzeri RCH2)
MAKEKFERNKPHVNVGTIGHVDHGKTTLTAALTRVCSEVFGSARVDFDKIDSAPEEKARG
ITINTAHVEYDSNIRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLSRQVGVPYIVVFLNKADMVDDAELLELVEMEVRDLLSTYDFPGDDTPIIIGSALMALN
GQDDNEMGTTAVKKLVETLDTYIPEPVRAIDKPFLMPIEDVFSISGRGTVVTGRVERGIV
KIQEEIEIVGLRDTTKTTCTGVEMFRKLLDEGRAGENCGVLLRGTKRDDVERGQVLAKPG
TIKPHTKFEAEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGSCELPEGVEMVMPGDNV
KMVVTLIKPIAMEDGLRFAIREGGRTVGAGVVAKIVE