Protein Info for PGA1_c35840 in Phaeobacter inhibens DSM 17395

Annotation: flagellum-specific ATP synthase FliI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 442 TIGR01026: ATPase, FliI/YscN family" amino acids 9 to 422 (414 residues), 445 bits, see alignment E=1.4e-137 PF00006: ATP-synt_ab" amino acids 146 to 357 (212 residues), 259.6 bits, see alignment E=2.2e-81 PF18269: T3SS_ATPase_C" amino acids 366 to 416 (51 residues), 39.8 bits, see alignment 3.2e-14

Best Hits

Swiss-Prot: 46% identical to FLII_TREPA: Flagellum-specific ATP synthase (fliI) from Treponema pallidum (strain Nichols)

KEGG orthology group: K02412, flagellum-specific ATP synthase [EC: 3.6.3.14] (inferred from 78% identity to sit:TM1040_2966)

Predicted SEED Role

"Flagellum-specific ATP synthase FliI" in subsystem Flagellar motility or Flagellum

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E5V3 at UniProt or InterPro

Protein Sequence (442 amino acids)

>PGA1_c35840 flagellum-specific ATP synthase FliI (Phaeobacter inhibens DSM 17395)
MISAINALTQDLANKKLSSAVGRVSEISGGAITVSGLNGQARIGDRLILRRAGSDPLEGE
VMRISGSEVSMLPDTAPDRVAVGDAVLLHPTPDFAPADSWIGRVIDPFGAPLDGRPMMRG
EATRDLMAAPPKAASRRPMGERLATGLAVFNTILPIVKGQRVGLFAGSGVGKSTLLATLA
QNMEADVVVIALIGERGREVNHFVKDVLGDEGMQRAVVVAATSDQSALVRRRCAWSAMAV
AEHFRDQGKNVLFLADSVTRFAEAHREIAVSSGEAPALRGYPPSVTPLITGLCERAGPGS
GDQGDITAIFSVLVAGSDMDEPIADILRGVLDGHIVLNREIAERGRFPAVDVSRSVSRSL
PAAATADENSAILDVRKYLGAYEQSEVMIRAGLYSEGNDVTLDQAVKLWPELDSFFGRSD
PEGVQSSFNRLMLMMRRAVAIR