Protein Info for Psest_3594 in Pseudomonas stutzeri RCH2

Annotation: Ribosomal protein L5

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 179 PF00281: Ribosomal_L5" amino acids 24 to 80 (57 residues), 94.2 bits, see alignment E=4.7e-31 PF00673: Ribosomal_L5_C" amino acids 84 to 177 (94 residues), 137.7 bits, see alignment E=1.1e-44

Best Hits

Swiss-Prot: 99% identical to RL5_PSEU5: 50S ribosomal protein L5 (rplE) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K02931, large subunit ribosomal protein L5 (inferred from 99% identity to psa:PST_0796)

MetaCyc: 69% identical to 50S ribosomal subunit protein L5 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L5p (L11e)" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GQM1 at UniProt or InterPro

Protein Sequence (179 amino acids)

>Psest_3594 Ribosomal protein L5 (Pseudomonas stutzeri RCH2)
MARLKEVYRKEIAPKLMEELQLKNVMEVPRITKITLNMGIGEAIGDKKIIDNAVADLEKI
TGQKVVVTHARKSIAGFKVREGWPIGVKVTLRSDRMYEFLDRLLSISLPRVRDFRGLNAK
SFDGRGNYSMGVKEQIIFPEIDYDKIDALRGLDITLTTTARTDEEGRALLRAFNFPFRN