Protein Info for PGA1_c35810 in Phaeobacter inhibens DSM 17395

Annotation: putative flagellar hook-basal body complex protein FliE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 98 PF02049: FliE" amino acids 26 to 98 (73 residues), 62.6 bits, see alignment E=1.6e-21

Best Hits

KEGG orthology group: K02408, flagellar hook-basal body complex protein FliE (inferred from 78% identity to sit:TM1040_2963)

Predicted SEED Role

"flagellar hook-basal body complex protein FliE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DVX3 at UniProt or InterPro

Protein Sequence (98 amino acids)

>PGA1_c35810 putative flagellar hook-basal body complex protein FliE (Phaeobacter inhibens DSM 17395)
MDIRSLSATTGYAAARPATKVDPEHMPSSAEAKIKASFEEFAGTLQQSEQVSVTAMTGNG
DPHALVQALAQTELAVETAVTVRNKVVEAYQEILRMPV