Protein Info for HP15_3468 in Marinobacter adhaerens HP15

Annotation: protein containing Type IV / VI secretion system, DotU domains

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 transmembrane" amino acids 168 to 184 (17 residues), see Phobius details amino acids 235 to 258 (24 residues), see Phobius details TIGR03349: type IV/VI secretion system protein, DotU family" amino acids 53 to 262 (210 residues), 225.6 bits, see alignment E=2.9e-71 PF09850: DotU" amino acids 55 to 257 (203 residues), 230.7 bits, see alignment E=7e-73

Best Hits

KEGG orthology group: K11892, type VI secretion system protein ImpK (inferred from 82% identity to maq:Maqu_3725)

Predicted SEED Role

"Outer membrane protein ImpK/VasF, OmpA/MotB domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PFG1 at UniProt or InterPro

Protein Sequence (275 amino acids)

>HP15_3468 protein containing Type IV / VI secretion system, DotU domains (Marinobacter adhaerens HP15)
MEDAQVMDLPNGSRNSGSSAFSDLIFADSRGAAEGNREGQVDEHFQLRGLEHNRLIDAAT
PLLGLVIRIRRLADYRAVEILYQQVVDDISAIDRELVEQGYDRPVVVAYRYVLCAFIDEA
VLGTDWGAHSIWSQHSLLSRFHNETWGGEKVFAILARMEQEPARYRDMLSFIYLCLCLGF
EGRYKVMENGRDEYDQIVRGLHEQLKALQEEQEPAPLADARANVTPTRNRLRSGIPVWGI
AGLFVAAMAGIYSLYNIALNERITDVLRVLDQLPK