Protein Info for PGA1_c35720 in Phaeobacter inhibens DSM 17395

Annotation: flagellar biosynthetic protein FliR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details amino acids 47 to 66 (20 residues), see Phobius details amino acids 73 to 93 (21 residues), see Phobius details amino acids 100 to 121 (22 residues), see Phobius details amino acids 127 to 148 (22 residues), see Phobius details amino acids 154 to 171 (18 residues), see Phobius details amino acids 183 to 205 (23 residues), see Phobius details amino acids 213 to 240 (28 residues), see Phobius details PF01311: Bac_export_1" amino acids 22 to 247 (226 residues), 150.5 bits, see alignment E=3.1e-48

Best Hits

KEGG orthology group: K02421, flagellar biosynthetic protein FliR (inferred from 65% identity to sit:TM1040_2954)

Predicted SEED Role

"Flagellar biosynthesis protein FliR" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F1S8 at UniProt or InterPro

Protein Sequence (259 amino acids)

>PGA1_c35720 flagellar biosynthetic protein FliR (Phaeobacter inhibens DSM 17395)
MNLDFLPPELVALLGAGFWHGAIVFLRIGAMVSVLPAFGEKYVPARIKLAISLAFTLIVA
PALPILPPPASPLHYGSLALSEAVVGLALGMAIRMFVHAIQIAGTIAAQSTSLAQVLGGI
GAEPMPAIGAVLLISGLALAVMLGLHIRVAEFMIYSYMMFPVGEFPSASGLSDWGVHRVS
RSFAMGFSLAAPFLIGSMVYNLTLGVINRAMPALMVAFVGAPVVTFGGLAILMVASPMIL
DIWSTALMGFFANPGEGMP