Protein Info for Psest_3579 in Pseudomonas stutzeri RCH2
Annotation: ribosomal protein L17
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 99% identical to RL17_PSEU5: 50S ribosomal protein L17 (rplQ) from Pseudomonas stutzeri (strain A1501)
KEGG orthology group: K02879, large subunit ribosomal protein L17 (inferred from 91% identity to pfs:PFLU5501)MetaCyc: 75% identical to 50S ribosomal subunit protein L17 (Escherichia coli K-12 substr. MG1655)
Predicted SEED Role
"LSU ribosomal protein L17p" in subsystem Ribosome LSU bacterial
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See L0GMW0 at UniProt or InterPro
Protein Sequence (128 amino acids)
>Psest_3579 ribosomal protein L17 (Pseudomonas stutzeri RCH2) MRHRKSGRHLSRTSAHRKAMFQNMAVSLFEHELIKTTLPKAKELRRVAEPLITLAKEDSV ANRRLAFDRTRSKAAVGKLFNDLGKRYATRQGGYLRILKCGFRAGDNAPMAYVELVDRPV TGEVEAAE