Protein Info for Psest_3575 in Pseudomonas stutzeri RCH2

Annotation: Arabinose efflux permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 455 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 51 to 71 (21 residues), see Phobius details amino acids 81 to 100 (20 residues), see Phobius details amino acids 106 to 127 (22 residues), see Phobius details amino acids 139 to 159 (21 residues), see Phobius details amino acids 168 to 188 (21 residues), see Phobius details amino acids 221 to 241 (21 residues), see Phobius details amino acids 253 to 273 (21 residues), see Phobius details amino acids 283 to 300 (18 residues), see Phobius details amino acids 306 to 325 (20 residues), see Phobius details amino acids 343 to 364 (22 residues), see Phobius details amino acids 370 to 391 (22 residues), see Phobius details PF07690: MFS_1" amino acids 20 to 354 (335 residues), 149.3 bits, see alignment E=2.9e-47 amino acids 257 to 395 (139 residues), 40.3 bits, see alignment E=3.9e-14 PF00083: Sugar_tr" amino acids 51 to 189 (139 residues), 32.1 bits, see alignment E=1.2e-11 PF21987: YajR_YAM" amino acids 400 to 454 (55 residues), 34.6 bits, see alignment 2.5e-12

Best Hits

KEGG orthology group: None (inferred from 97% identity to psa:PST_0813)

Predicted SEED Role

"Putative transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GRX9 at UniProt or InterPro

Protein Sequence (455 amino acids)

>Psest_3575 Arabinose efflux permease (Pseudomonas stutzeri RCH2)
MQDPYSERMSASEKRAASGLALVFAFRMLGMFMVLPVLATYGMDLEGATPTLIGLAIGAY
GLTQALLQIPFGILSDRIGRLPIIYFGLLIFAAGAALAAMSDSIWGVVAGRILQGAGAIS
AAVMALLSDLTREQHRTKAMALIGVSIGFSFAVAMIVGPLLTRAFGLSGLFWVTAGMAVL
GGVIVAVLPKAEAHVRHRESGVAKQALGLTLRHPDLLRLDFSILALHAILMASFVALPLA
LVEQGALPKEEHWWVYLTALLVGFFGMIPFIIYGEKKRQMRRVLLGAVTALLICELFFWW
FGNGLWMLVVGMVGFFIAFNLLEASLPSLISKVAPAGGKGTAMGVYSTSQFLGAGLGGVL
GGVLYQQGGLALVFAGCAALCALWFLVAFSMREPPYVTSLRLPLSTGALANAGLGDDLLQ
VTGVSDVLIVIEEAAAYIKVDTQQLDREALDRLVA