Protein Info for Psest_3569 in Pseudomonas stutzeri RCH2

Annotation: Biopolymer transport proteins

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 448 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 265 to 288 (24 residues), see Phobius details amino acids 355 to 378 (24 residues), see Phobius details amino acids 395 to 418 (24 residues), see Phobius details PF01618: MotA_ExbB" amino acids 326 to 430 (105 residues), 103.4 bits, see alignment E=3.7e-34

Best Hits

KEGG orthology group: K03561, biopolymer transport protein ExbB (inferred from 96% identity to psa:PST_0819)

Predicted SEED Role

"MotA/TolQ/ExbB proton channel family protein" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GMV0 at UniProt or InterPro

Protein Sequence (448 amino acids)

>Psest_3569 Biopolymer transport proteins (Pseudomonas stutzeri RCH2)
MSRLFSLFLVALLPLAAHAAEPLSPDQLLERIRSDRAAEVSAMQAREQAFVRDRGEQQQL
LARARAALAEQKAEAERQKADFDRQEAELAEQEKLLAQRVGHLGELFGVVRQSAGDIAGQ
WQDSMLNAQYPERLTQLRSLAESRALPSADDLDAFWMTLLEDLAASGRVERIQLPVVGTD
GARSEQPVLRVGSFSAFTDNAFLRYDADAGELLVPTRQPSGQGLIGDYLKSSDALATLPL
DPSRGTLIAQLQRQPDLWDRVKQGGLVGGVILVLGAIGLLLAIWRMVYLGGIGRKVGSQM
RELNHPRDDNPLGRIIGVLGPKPQLSDLETLELKLDEAILQETPPLERGQPLLKLLAAVA
PLLGLLGTVTGMIITFQAITQSGGGDSRLMADGISQALVTTVLGLVVAIPLLFLHSLLAS
RSKALIQLLEQQSAGLIALHLSGASRRD