Protein Info for HP15_3446 in Marinobacter adhaerens HP15

Annotation: protein containing a von Willebrand factor type A (vWA) domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 704 transmembrane" amino acids 28 to 47 (20 residues), see Phobius details amino acids 678 to 698 (21 residues), see Phobius details TIGR03788: marine proteobacterial sortase target protein" amino acids 75 to 701 (627 residues), 779.4 bits, see alignment E=1.4e-238 PF08487: VIT" amino acids 77 to 184 (108 residues), 114.3 bits, see alignment E=8.1e-37 PF13757: VIT_2" amino acids 78 to 137 (60 residues), 30.2 bits, see alignment 8.5e-11 PF00092: VWA" amino acids 344 to 490 (147 residues), 53.6 bits, see alignment E=8.5e-18 PF13768: VWA_3" amino acids 344 to 498 (155 residues), 82.5 bits, see alignment E=8.7e-27 PF13519: VWA_2" amino acids 345 to 451 (107 residues), 50.9 bits, see alignment E=5.4e-17

Best Hits

KEGG orthology group: K07114, uncharacterized protein (inferred from 62% identity to maq:Maqu_3684)

Predicted SEED Role

"Inter-alpha-trypsin inhibitor domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PFD9 at UniProt or InterPro

Protein Sequence (704 amino acids)

>HP15_3446 protein containing a von Willebrand factor type A (vWA) domain (Marinobacter adhaerens HP15)
MIISSSLLKLYSRPSANSGQRIRLKRCLEGISLWLAVMLMLFVHPLYAEANETDNVGQFH
FVDGQGQWQEPALVLESDFDVRISGLIADSRLLRRFRNTSDRWREGVFVFPLPEKASVYG
LTMKVGERTIEGKVQPKETARRTYEKAKQAGQHAANVEKQRPNLFTARVANIPPGETVSV
ELKYQQPVQYQAGVFELTVPTTLTPRYMPGKALSAAPDQWQGGWAVPTTEVPDAVAISPF
TVNPGDVADDSHRAVINLVIDSGLPLQSVSSPSHRLATSQDGQTFSVRPDGGEILMDRDF
VVRWRPVAGQEPSAAVFHQSWEGEDYLMAMLVPGESGAMALPRDLVFVIDTSGSMAGESI
RQARDALQAGLGTLTPRDRFNVIQFNSQTHSLFMQPEVATGNNLARARQYVDRLRADGGT
EMAPALSRALEGGGETEDGARVRQVIFITDGAVGNEAALFRQIRQQLGNQRLFTVAIGSA
PNRHFMREAARWGRGTYTAIHSPSDVDGPLQALFSAMESPVLTDIGVNWPGQKAGQESFP
RRPGDLFQGEPLIHVVRGVPAMGQLEVSGRLPGGRDWTRTLDLQQAAPATGLHRHWAREK
IDSLEDEAKVTGREPDEAGLTELAVQHGLMSAYTSFVAVDSTPARSSEAPMESDNLPTLL
PAGSQAGMLRYPQTATSAPLLIALGLVGLMFSLAIVLLQRRAFA