Protein Info for Psest_3567 in Pseudomonas stutzeri RCH2

Annotation: Biopolymer transport protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 137 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details PF02472: ExbD" amino acids 10 to 133 (124 residues), 116.3 bits, see alignment E=4.8e-38

Best Hits

Swiss-Prot: 54% identical to EXBD2_VIBCH: Biopolymer transport protein exbD2 (exbD2) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K03559, biopolymer transport protein ExbD (inferred from 98% identity to psa:PST_0821)

Predicted SEED Role

"Biopolymer transport protein ExbD/TolR" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GPZ5 at UniProt or InterPro

Protein Sequence (137 amino acids)

>Psest_3567 Biopolymer transport protein (Pseudomonas stutzeri RCH2)
MRMRRHHYQQEEDTGIDLTPMLDVVFIMLIFFIVTSSFIKESGVEVHRPQADTASAQDKG
NILIAVTADGQVWIDKQAVDVRSVRAHVERLRVDQPEGAVVVQADQDARTGLVVQVMDQA
RQAGVQDVALAASTGAR