Protein Info for Psest_3563 in Pseudomonas stutzeri RCH2

Annotation: ABC-type transport system, involved in lipoprotein release, permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 421 transmembrane" amino acids 16 to 35 (20 residues), see Phobius details amino acids 268 to 285 (18 residues), see Phobius details amino acids 291 to 315 (25 residues), see Phobius details amino acids 335 to 364 (30 residues), see Phobius details amino acids 385 to 406 (22 residues), see Phobius details PF12704: MacB_PCD" amino acids 19 to 211 (193 residues), 53.3 bits, see alignment E=4.6e-18 PF02687: FtsX" amino acids 294 to 412 (119 residues), 68.7 bits, see alignment E=4.8e-23

Best Hits

KEGG orthology group: K02004, (no description) (inferred from 96% identity to psa:PST_0825)

Predicted SEED Role

"ABC-type antimicrobial peptide transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GQJ2 at UniProt or InterPro

Protein Sequence (421 amino acids)

>Psest_3563 ABC-type transport system, involved in lipoprotein release, permease component (Pseudomonas stutzeri RCH2)
MYLLRLALASLNNRRFTALLTVFAIALSVCLLLAVERVRNETRASFANTISGTDLVVGAR
SGSVNLLLYSVFRIGNATNNIRWDSYQRFAEHPRVDWAIPISLGDSHRGYRVMGTSTNYF
EHYRYGRKQPLQLAEGRAFESDPFEVVLGAEVASALGYQLDDSIVLAHGVARVSLVQHED
KPFRVVGVLQRTGTPVDRTLHISLEGMEALHVDWQNGMPARGAARIDAEQARQLDLQPQQ
ITAFLLGLNSKIATFTLQREINEYRGEPLLAILPGVALQELWSLMGTAEKALFVVSLFVV
LTGLIGMLTAILTSLNERRREMAILRSVGARPWHIAALLIIEAFGLALAGTLLGLALLYL
GIAVAQSPLQSLYGLYLPLAWPSSYEWSLLGAILLAALLMGSVPAWRAYRQSLADGLSIR
L