Protein Info for Psest_3557 in Pseudomonas stutzeri RCH2

Annotation: Predicted redox protein, regulator of disulfide bond formation

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 79 PF01206: TusA" amino acids 10 to 76 (67 residues), 68.9 bits, see alignment E=1.4e-23

Best Hits

Swiss-Prot: 46% identical to YEDF_SALTI: Putative sulfur carrier protein YedF (yedF) from Salmonella typhi

KEGG orthology group: None (inferred from 86% identity to pag:PLES_14031)

Predicted SEED Role

"UPF0033 protein YedF"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GPY9 at UniProt or InterPro

Protein Sequence (79 amino acids)

>Psest_3557 Predicted redox protein, regulator of disulfide bond formation (Pseudomonas stutzeri RCH2)
MSQAKPNLSLDLRGEHCPYNAIATLETLETMQPGQLLEVVTDCSQSVHGIPEDAKAKGYN
CLAVEQHGALFRFLIEVPR