Protein Info for Psest_3556 in Pseudomonas stutzeri RCH2

Annotation: 2'-5' RNA ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 173 TIGR02258: 2'-5' RNA ligase" amino acids 7 to 170 (164 residues), 109.8 bits, see alignment E=7.4e-36 PF13563: 2_5_RNA_ligase2" amino acids 15 to 155 (141 residues), 53.1 bits, see alignment E=3.8e-18 PF02834: LigT_PEase" amino acids 15 to 82 (68 residues), 39.2 bits, see alignment E=6.7e-14 amino acids 90 to 161 (72 residues), 28.7 bits, see alignment E=1.3e-10

Best Hits

KEGG orthology group: K01975, 2'-5' RNA ligase [EC: 6.5.1.-] (inferred from 70% identity to psa:PST_0832)

Predicted SEED Role

"2'-5' RNA ligase"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.5.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GRP5 at UniProt or InterPro

Protein Sequence (173 amino acids)

>Psest_3556 2'-5' RNA ligase (Pseudomonas stutzeri RCH2)
MSEENLRLFFALPCPPEQAAAICAWRDDQAIDGRAVPRDNLHLTLAFLGAQPKDHLDALL
QMAATVQTDSFSLTLDRLTTIGKGFICLQPSNTNPALLQLVEALSERLAALGVILDCRPF
LPHLTLSRQARSRPQQPAPDFSWHVDRFVLYRSRNTEDGVHYDELGSWPLAAP