Protein Info for HP15_3431 in Marinobacter adhaerens HP15

Annotation: multi-sensor signal transduction histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 607 PF01590: GAF" amino acids 4 to 76 (73 residues), 48.4 bits, see alignment E=3.7e-16 amino acids 108 to 243 (136 residues), 38.3 bits, see alignment E=4.8e-13 PF08447: PAS_3" amino acids 280 to 351 (72 residues), 41.4 bits, see alignment E=3.6e-14 PF00512: HisKA" amino acids 377 to 444 (68 residues), 64.6 bits, see alignment E=1.7e-21 PF02518: HATPase_c" amino acids 492 to 602 (111 residues), 106.5 bits, see alignment E=2.7e-34

Best Hits

KEGG orthology group: None (inferred from 57% identity to maq:Maqu_3672)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PFC4 at UniProt or InterPro

Protein Sequence (607 amino acids)

>HP15_3431 multi-sensor signal transduction histidine kinase (Marinobacter adhaerens HP15)
MLREETLVIENALNDERFFDNPLVTGDPHIRFYAGAPLHDPQGQRVGTLCIIDRKPRSFS
EEDKTILRDLADLVEREFSIGAIRDHSEDRTRALNVLTEIVLDSAGDTNERAARALRIAC
DYLGLETGIVSRVTDTVYTIHWHFTRGTNPIENGTTLPLEQTYCALLLESSHKLFAIQNM
AESGFTNRPCYEVFGLETYLAAPIWIDGEIFGTVNFSSHSPRHRPFSATEEMFVTLFADW
VADTLYRVQRTETLNKLVTQAPGMLYQYRLWPDGHSSFPYTSPGIKEIYGIDVEEAAIDA
NKAIARVHPDDLPELLKSIEESAQTLSQWQLRYRVRLDTGGWSWVEGLAQPEALPDESIL
WHGYITNVDERQRIDEMKNQFISTVSHELRTPLTSISGSLGLILGGATGPVNEKTAQMLT
IAQRNSKQLRHLIDDLLDIEKLVSGNVTFDASVQRLDEAAEAAIEEIQPMARKRGVEVQL
NVLERDLYANYDIVRLTQAITNLLSNAIKFSPAGAAVRVDLSKSGDEAKLEVRDQGPGVP
ESFRDRIFQKFAQANSTSSRTKEGTGLGLAITRELMQAMGGEVDFESEEGSGACFWITLP
LAEPGTQ