Protein Info for Psest_3549 in Pseudomonas stutzeri RCH2

Annotation: 6,7-dimethyl-8-ribityllumazine synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 158 TIGR00114: 6,7-dimethyl-8-ribityllumazine synthase" amino acids 16 to 151 (136 residues), 182.1 bits, see alignment E=2.7e-58 PF00885: DMRL_synthase" amino acids 16 to 152 (137 residues), 193.6 bits, see alignment E=7.2e-62

Best Hits

Swiss-Prot: 99% identical to RISB_PSEU5: 6,7-dimethyl-8-ribityllumazine synthase (ribH) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K00794, 6,7-dimethyl-8-ribityllumazine synthase [EC: 2.5.1.78] (inferred from 99% identity to psa:PST_0838)

MetaCyc: 56% identical to 6,7-dimethyl-8-ribityllumazine synthase (Escherichia coli K-12 substr. MG1655)
LUMAZINESYN-RXN [EC: 2.5.1.78]

Predicted SEED Role

"6,7-dimethyl-8-ribityllumazine synthase (EC 2.5.1.78)" (EC 2.5.1.78)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.78

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GMT1 at UniProt or InterPro

Protein Sequence (158 amino acids)

>Psest_3549 6,7-dimethyl-8-ribityllumazine synthase (Pseudomonas stutzeri RCH2)
MPLKTIEGTFIAPQGKYALVVGRFNSFVVESLVSGAVDALVRHGVSENDITIIRAPGAFE
IPLVAQKVAQQGEYDAIVALGAVIRGGTPHFEYVAGECTKGLAQVSMEFGVPVAFGVLTV
DSIEQAIERSGTKAGNKGAEAALSALEMVSLLSQLEAK