Protein Info for Psest_3549 in Pseudomonas stutzeri RCH2

Annotation: 6,7-dimethyl-8-ribityllumazine synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00885: DMRL_synthase
  • amino acids 16 to 152 (137 residues), 193.9 bits, E=5.9e-62
• TIGR00114: 6,7-dimethyl-8-ribityllumazine synthase
  • amino acids 16 to 151 (136 residues), 182.1 bits, E=2.7e-58

Best Hits

Swiss-Prot: 99% identical to RISB_PSEU5: 6,7-dimethyl-8-ribityllumazine synthase (ribH) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K00794, 6,7-dimethyl-8-ribityllumazine synthase [EC: 2.5.1.78] (inferred from 99% identity to psa:PST_0838)

MetaCyc: 56% identical to 6,7-dimethyl-8-ribityllumazine synthase (Escherichia coli K-12 substr. MG1655)
LUMAZINESYN-RXN [EC: 2.5.1.78]

Predicted SEED Role

"6,7-dimethyl-8-ribityllumazine synthase (EC 2.5.1.78)" (EC 2.5.1.78)

MetaCyc Pathways

• flavin biosynthesis I (bacteria and plants) (8/9 steps found)
• flavin biosynthesis III (fungi) (7/9 steps found)
• flavin biosynthesis II (archaea) (5/10 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.78

Sequence Analysis Tools

See L0GMT1 at UniProt or InterPro

Protein Sequence (158 amino acids)

>Psest_3549 6,7-dimethyl-8-ribityllumazine synthase (Pseudomonas stutzeri RCH2)
MPLKTIEGTFIAPQGKYALVVGRFNSFVVESLVSGAVDALVRHGVSENDITIIRAPGAFE
IPLVAQKVAQQGEYDAIVALGAVIRGGTPHFEYVAGECTKGLAQVSMEFGVPVAFGVLTV
DSIEQAIERSGTKAGNKGAEAALSALEMVSLLSQLEAK