Protein Info for PGA1_c35350 in Phaeobacter inhibens DSM 17395

Annotation: uncharacterized P-loop hydrolase UPF0079

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02367: TsaE
  • amino acids 12 to 131 (120 residues), 118.7 bits, E=8.4e-39
• TIGR00150: tRNA threonylcarbamoyl adenosine modification protein YjeE
  • amino acids 12 to 140 (129 residues), 94.7 bits, E=2.2e-31

Best Hits

Swiss-Prot: 36% identical to TSAE_SHIFL: tRNA threonylcarbamoyladenosine biosynthesis protein TsaE (tsaE) from Shigella flexneri

KEGG orthology group: K06925, UPF0079 ATP-binding protein (inferred from 62% identity to sit:TM1040_2842)

MetaCyc: 36% identical to N6-L-threonylcarbamoyladenine synthase, TsaE subunit (Escherichia coli K-12 substr. MG1655)
RXN-14570 [EC: 2.3.1.234]

Predicted SEED Role

"TsaE protein, required for threonylcarbamoyladenosine t(6)A37 formation in tRNA"

MetaCyc Pathways

• N⁶-L-threonylcarbamoyladenosine³⁷-modified tRNA biosynthesis (1/2 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.234

Sequence Analysis Tools

See I7DVT0 at UniProt or InterPro

Protein Sequence (159 amino acids)

>PGA1_c35350 uncharacterized P-loop hydrolase UPF0079 (Phaeobacter inhibens DSM 17395)
MTTQKTLVIPLPSPEATTNLATRLGAELSNGDCLLLSGIIGAGKTHFARSLIQSEMTVPE
DVPSPTFTLVQTYDLPNGELWHADLYRLSSLDEIEELGLISAFESAICLIEWPDRLAELT
PAAALHISLALDPNEDDARIATLRWSDARWEPLMKQITP