Protein Info for Psest_3546 in Pseudomonas stutzeri RCH2

Annotation: Phosphatidylglycerophosphatase A and related proteins

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 165 transmembrane" amino acids 56 to 75 (20 residues), see Phobius details amino acids 95 to 120 (26 residues), see Phobius details amino acids 139 to 164 (26 residues), see Phobius details PF04608: PgpA" amino acids 23 to 160 (138 residues), 154 bits, see alignment E=1.3e-49

Best Hits

Swiss-Prot: 58% identical to PGPA_ECOLI: Phosphatidylglycerophosphatase A (pgpA) from Escherichia coli (strain K12)

KEGG orthology group: K01095, phosphatidylglycerophosphatase A [EC: 3.1.3.27] (inferred from 97% identity to psa:PST_0841)

MetaCyc: 58% identical to phosphatidylglycerophosphatase A (Escherichia coli K-12 substr. MG1655)
Phosphatidylglycerophosphatase. [EC: 3.1.3.27]

Predicted SEED Role

"Phosphatidylglycerophosphatase A (EC 3.1.3.27)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 3.1.3.27)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GRP1 at UniProt or InterPro

Protein Sequence (165 amino acids)

>Psest_3546 Phosphatidylglycerophosphatase A and related proteins (Pseudomonas stutzeri RCH2)
MTDSSPVAAKPQTLVWSNPWHNLAFGFGSGLMPKAPGTWGSLVALPFVPLWQLLPGWGYL
LMLGLTMLFGVWLCGKVARELGVHDHEGIVWDEFVGIWITFWLVPEGWYWMLLGFVIFRV
MDIAKPWPISWVDRHIHGGFGIMLDDILAGVAAWVVMQGLVALLV