Protein Info for Psest_3545 in Pseudomonas stutzeri RCH2

Annotation: clan AA aspartic protease, TIGR02281 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details TIGR02281: clan AA aspartic protease, TIGR02281 family" amino acids 94 to 211 (118 residues), 136.4 bits, see alignment E=2.8e-44 PF13975: gag-asp_proteas" amino acids 107 to 198 (92 residues), 102.8 bits, see alignment E=1.9e-33 PF13650: Asp_protease_2" amino acids 108 to 195 (88 residues), 87.5 bits, see alignment E=1.3e-28

Best Hits

KEGG orthology group: K06985, aspartyl protease family protein (inferred from 96% identity to psa:PST_0842)

Predicted SEED Role

"Transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GRV1 at UniProt or InterPro

Protein Sequence (215 amino acids)

>Psest_3545 clan AA aspartic protease, TIGR02281 family (Pseudomonas stutzeri RCH2)
MRSIPIVFASLLLLPALAQAASMVQVVGLFPGAAVVNVDGQRKLVKVGQTGPGGVQVISA
DASGAVLRVDGVERHYNLSREYSGAYATPSKTQLSVAKGTGGHYWIAGAINGQPIQFLVD
TGATSVAINEHQARRLGIDYRVNGRPMVVSTASGTAKAWRVHLNSVKVGAIEVIGVEAVV
VEGGSPTEALLGMSFLGRVSWREEQGVLVLESKTS