Protein Info for HP15_3422 in Marinobacter adhaerens HP15

Annotation: diguanylate cyclase/phosphodiesterase with PAS/PAC and GAF sensor(s)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 759 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 314 to 334 (21 residues), see Phobius details PF12974: Phosphonate-bd" amino acids 32 to 282 (251 residues), 166.8 bits, see alignment E=1.7e-52 TIGR00229: PAS domain S-box protein" amino acids 343 to 471 (129 residues), 35.1 bits, see alignment E=1.2e-12 amino acids 472 to 588 (117 residues), 47.2 bits, see alignment E=2.4e-16 PF13426: PAS_9" amino acids 367 to 463 (97 residues), 34 bits, see alignment E=8.9e-12 amino acids 484 to 579 (96 residues), 45.6 bits, see alignment E=2.2e-15 PF13188: PAS_8" amino acids 477 to 517 (41 residues), 20.5 bits, see alignment 1e-07 PF00989: PAS" amino acids 478 to 578 (101 residues), 35.9 bits, see alignment E=2e-12 PF08448: PAS_4" amino acids 483 to 582 (100 residues), 28.3 bits, see alignment E=5.5e-10 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 589 to 752 (164 residues), 142.1 bits, see alignment E=1.4e-45 PF00990: GGDEF" amino acids 592 to 750 (159 residues), 160.8 bits, see alignment E=7.6e-51

Best Hits

KEGG orthology group: None (inferred from 63% identity to maq:Maqu_3664)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PFB5 at UniProt or InterPro

Protein Sequence (759 amino acids)

>HP15_3422 diguanylate cyclase/phosphodiesterase with PAS/PAC and GAF sensor(s) (Marinobacter adhaerens HP15)
MNIRRFAACLCFLFATEFVAMASASADETLTMGVFAYRPDSVLQERYQPLTDYLSRETGI
SVRLEVLNQENMSRAIAANRLDFFLTNPSHFLLIRSERSLTGVLATLVRRSGQSSTGSLG
GVIFTRAERDDIEQLADIRDKTIASPGVHFLGGYQTQVLELLDAGIDIRRVNLIRFMGTH
DRVVRSVLSGDADVGFIRTSILEQMAQEDPDLFTKVKVLNRQRLAGFPYVVSTRLYPEWP
LVALPHVNERAVRRIASALFAIEPEDEVALSVGISGFSPPADYQSVEYLARTLRVPPYDQ
APQLTWVDALHQYRLWVFTILVLLMLLVASSLWLGKSKRQLAAEQRRLRQLIRGWPQAAL
LIRGGLFIDTNRASVDLLRYTSSESLVGKDLAVFSPEFQPDGQISRQKMAPMLARVSAGQ
VEQCEWVLNRSDGTEIWVELTMAPVHTEDEPEALILCSLYEITLRKHAEQRQRLAASVFE
YAREAIFITDNHGIVIDANDAYLAITGRPRNRAIGRLPPLPVEEGSGIFASARSQGFWSG
EFASRRNDGEPITLSVTLSSVRGDHGEVSHFVGIFSDISRLKEQERKLRIMAHYDALTGM
PNRVLFADRLQQAMALTRRQSGKLAVVYIDLDEFKPVNDAFGHEAGDQLLVEIAHRMRSE
LREEDTLARIGGDEFAAIVMNVQDDPALESLLMRLLARVAEPVWVADHSVEVSASIGYTL
FPQAEDLDGDQLLRQADQAMYQAKHRGRNRYVRFSDPSS