Protein Info for PGA1_c35240 in Phaeobacter inhibens DSM 17395

Annotation: ATP-dependent hsl protease ATP-binding subunit HslU

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 436 TIGR00390: ATP-dependent protease HslVU, ATPase subunit" amino acids 4 to 436 (433 residues), 595.6 bits, see alignment E=3.3e-183 PF07728: AAA_5" amino acids 52 to 88 (37 residues), 22.4 bits, see alignment 1.6e-08 PF00004: AAA" amino acids 53 to 101 (49 residues), 25.5 bits, see alignment 2.4e-09 amino acids 230 to 325 (96 residues), 28.9 bits, see alignment E=2.1e-10 PF07724: AAA_2" amino acids 204 to 322 (119 residues), 90.5 bits, see alignment E=2e-29

Best Hits

Swiss-Prot: 89% identical to HSLU_RUEST: ATP-dependent protease ATPase subunit HslU (hslU) from Ruegeria sp. (strain TM1040)

KEGG orthology group: K03667, ATP-dependent HslUV protease ATP-binding subunit HslU (inferred from 89% identity to sit:TM1040_2851)

Predicted SEED Role

"ATP-dependent hsl protease ATP-binding subunit HslU" in subsystem Proteasome bacterial or Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F3X9 at UniProt or InterPro

Protein Sequence (436 amino acids)

>PGA1_c35240 ATP-dependent hsl protease ATP-binding subunit HslU (Phaeobacter inhibens DSM 17395)
MTDLTPREIVSELDRFIIGQTDAKRAVAVALRNRWRRKQLGDDLRDEVYPKNILMIGPTG
VGKTEISRRLAKLARAPFIKVEATKFTEVGYVGRDVEQIIRDLVDIAIVQTREHMRDDVK
AKARQAAEERVIDAIAGTDARDATRDMFRKKLKAGELDDTIIELDVSDTSNPMGGMFEIP
GQPGGNMGMMNLGDLFGKAMGGRTTRKKMTVANSYDVLIGEEADKLLDDETVTKAALESV
EQNGIVFLDEIDKVCTRQDARGGDVSREGVQRDLLPLIEGTTVSTKHGPVKTDHILFIAS
GAFHIAKPSDLLPELQGRLPIRVNLRALSEEDFVRILTETDNALTLQYTALLGTEEVNVS
FTDDGIASLAKIAAEVNQTVENIGARRLYTVIERVFEELSFSAPDRSGETVTVDAAFVRK
NLGELTKSADVSRYVL