Protein Info for HP15_3412 in Marinobacter adhaerens HP15

Annotation: protein of unknown function, ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 718 transmembrane" amino acids 101 to 119 (19 residues), see Phobius details PF08351: TmcA_N" amino acids 16 to 163 (148 residues), 70.9 bits, see alignment E=2.1e-23 PF05127: NAT10_TcmA_helicase" amino acids 210 to 378 (169 residues), 191.2 bits, see alignment E=3.7e-60 PF13718: GNAT_acetyltr_2" amino acids 415 to 530 (116 residues), 41.7 bits, see alignment E=2.3e-14

Best Hits

Predicted SEED Role

"Predicted P-loop ATPase fused to an acetyltransferase COG1444"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PFA5 at UniProt or InterPro

Protein Sequence (718 amino acids)

>HP15_3412 protein of unknown function, ATPase (Marinobacter adhaerens HP15)
MSHSGPDAKADPSAWRALQDSLTANGERRLVLLEGDREQNLRWLSGLLPGLEIQSGLWTG
PADHSPDTRLTRVTPPGARKWLGCEVSLIVWDGWHGNPPDAFAALSGALTAGGLLFWLMP
PLAEWSRFADPDYSRTGLEHGPNHPFAARMADLLADDDAVIRVSPDRPESRPPVPPLPEK
RFRIAATRDQEQLVQRLVRFGLGRRRRPLVVTADRGRGKSAAMGMAAAELLRQGRQDIVV
TAPSEQNVETLFRHACETLGDQLAEASPGILSSRAGGRLRFMPVRELLTLRPEAEVVLVD
EAAAIPAPLLKSVLLGWPRVAFATTVHGYEGAGRGFAIRFRQVLDQSTPQWQSVTLSEPV
RWTLNDPLEALITRLFLLAADGGRLPGKTEYSAGELVIEPWEPAEASDGALSRAFGLLVD
AHYRTSPADLRQWLDDPAARSWRARIGDQTVGVLWCALEGGLPAELAEQVSLGTRRIRGH
LLPQSLASHSGYPEAAVLRGLRVVRIAVSDEVRRAGIGQSMVQAARAYAAEQDVDYLGTS
FGGSADLLAFWQTCGLHVVRVGWQQEASSGEYPLQMVAGFSQAGRDLEERIRNRLADHWL
TLLPGNWQGLEPTLLAGITADLPPGPTLDRDDLRDLRNFANGHRGFQVTVPVLRKLSQAP
GIMAWLKSHEALAVWCQGVLQGRPWSALQADRLCLGQREGEDRLRQVVRDLLKDGPGL