Protein Info for Psest_3528 in Pseudomonas stutzeri RCH2

Annotation: Predicted membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 146 transmembrane" amino acids 31 to 52 (22 residues), see Phobius details amino acids 64 to 82 (19 residues), see Phobius details PF13670: PepSY_2" amino acids 66 to 144 (79 residues), 79.5 bits, see alignment E=1.5e-26 PF03413: PepSY" amino acids 90 to 143 (54 residues), 24.1 bits, see alignment E=3.8e-09

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GQG1 at UniProt or InterPro

Protein Sequence (146 amino acids)

>Psest_3528 Predicted membrane protein (Pseudomonas stutzeri RCH2)
MAMALWQSRLAPGEIDIGPAHARQLAVPRLNLAAVVALVIQAGAYSYGPIWFRSQKENEM
YNKTLTAAFAVAILGSGAAFAADKPGADWITLEQAVEKAKAAGYTELHGIEADDDGWEGE
GMKQDGKKYEFSIDGRTGEVTKEKED