Protein Info for PGA1_c35160 in Phaeobacter inhibens DSM 17395

Annotation: dephospho-CoA kinase CoaE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01121: CoaE
  • amino acids 4 to 174 (171 residues), 124.7 bits, E=1.8e-40
• TIGR00152: dephospho-CoA kinase
  • amino acids 5 to 182 (178 residues), 106.7 bits, E=6.7e-35

Best Hits

Swiss-Prot: 67% identical to COAE_RUEPO: Dephospho-CoA kinase (coaE) from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)

KEGG orthology group: K00859, dephospho-CoA kinase [EC: 2.7.1.24] (inferred from 67% identity to sil:SPO3890)

Predicted SEED Role

"Dephospho-CoA kinase (EC 2.7.1.24)" in subsystem Coenzyme A Biosynthesis (EC 2.7.1.24)

MetaCyc Pathways

• superpathway of coenzyme A biosynthesis I (bacteria) (8/9 steps found)
• superpathway of coenzyme A biosynthesis III (mammals) (5/5 steps found)
• coenzyme A biosynthesis I (bacteria) (4/4 steps found)
• coenzyme A biosynthesis II (eukaryotic) (4/4 steps found)

KEGG Metabolic Maps

• Pantothenate and CoA biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.24

Sequence Analysis Tools

See I7F1M7 at UniProt or InterPro

Protein Sequence (197 amino acids)

>PGA1_c35160 dephospho-CoA kinase CoaE (Phaeobacter inhibens DSM 17395)
MSYALGLTGSIGMGKSATAQIFADEGCAVWDADAAVHRLYDVGGAAVAPIGNAWPAAVIE
GRVDRGRLRDIIAGDRSALPRIEKIVHPLVAADREAFRASSSHDVLVFDIPLLFETGGDA
GMDAVACVWINDETQRQRVLARQTMTVEQFEQILQKQMPIEDKKARADYLIETDTPDHAK
AQVRSILAQIRRQIADA