Protein Info for HP15_3405 in Marinobacter adhaerens HP15

Annotation: histone deacetylase superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 PF00850: Hist_deacetyl" amino acids 26 to 312 (287 residues), 249.9 bits, see alignment E=1.8e-78

Best Hits

Swiss-Prot: 62% identical to APAHL_BURP1: Acetylpolyamine amidohydrolase (aphA) from Burkholderia pseudomallei (strain 1710b)

KEGG orthology group: None (inferred from 86% identity to maq:Maqu_3648)

Predicted SEED Role

"Acetylpolyamine aminohydrolase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PF98 at UniProt or InterPro

Protein Sequence (315 amino acids)

>HP15_3405 histone deacetylase superfamily (Marinobacter adhaerens HP15)
MRQPQEIPARTGEMLGGLRELGISVLQPADQGAGPISKVHDLGYLRFLESAHRRWKQMDD
WGDEVISNIFVRSPNHLTGILAEAARYQADGSCPIGEHTWHAAYWSAQSALGAADALIAG
DRTSYAVCRPPGHHARRDAAGGFCYLNNAAIAAEHMKARFPKIVILDTDMHHGQGIQEIF
YDRSDVLYISIHGDTTNFYPVVSGFENERGEGEGFGYNINMPMPHGSTEDDFFAKLDDAL
AAIKLFQPDAIILALGFDIYKNDPQAKVSVSSEGFCRLSTHVRQLGLPTLVVQEGGYDLD
ALSENVQQFFKGLAG