Protein Info for Psest_3526 in Pseudomonas stutzeri RCH2

Annotation: Short chain fatty acids transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 444 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 52 to 74 (23 residues), see Phobius details amino acids 94 to 123 (30 residues), see Phobius details amino acids 135 to 161 (27 residues), see Phobius details amino acids 181 to 203 (23 residues), see Phobius details amino acids 245 to 263 (19 residues), see Phobius details amino acids 274 to 293 (20 residues), see Phobius details amino acids 307 to 329 (23 residues), see Phobius details amino acids 341 to 358 (18 residues), see Phobius details amino acids 419 to 441 (23 residues), see Phobius details PF02667: SCFA_trans" amino acids 3 to 436 (434 residues), 424.3 bits, see alignment E=3.5e-131

Best Hits

KEGG orthology group: K02106, short-chain fatty acids transporter (inferred from 55% identity to bpt:Bpet4525)

Predicted SEED Role

"Short chain fatty acids transporter" in subsystem Polyhydroxybutyrate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GRM6 at UniProt or InterPro

Protein Sequence (444 amino acids)

>Psest_3526 Short chain fatty acids transporter (Pseudomonas stutzeri RCH2)
MNALANFFTRLVNRYMPDPLVIAMGLTVLTMLLAVLVEGSSPLDVTRYWGGGFWNLLAFS
MQMTVILLAGYILARTPLVDGLLDRIAGTVRTPFAAIVVATLVGTIGSWLNWGFGLVIGS
IVAQKLALKVPGLHYPLVIAAAFSGFSVYGIGLSGSVPLLIATEGHFLQDRMGLIPLSET
IFSAPLLIASALVVLTLPLFNAWLHPKNPRQIVEIDPTTVAIPFEPSLAGNTEATLADRM
NHSKVTGIVIGALGLFYVGLRFSDGGSLDLNTVNFIFVFLGILLFASPARYLAALAEGVK
IVSGIIIQYPFYAGIMGVLVGSGLVVSFAELFVRISTAETLPIWSFISGGLINILAPSGG
GQWAMQGPVVIEAARELNASLAATALGVQVGDQWTNMIQPFWILPALAISKLKLRDVMGY
MVLILGYLGLIFSGTIWIWGYLAA